• Gene id: 81562

Gene Summary

• Gene Symbol: LMAN2L   Gene   UCSC   Ensembl
• Aliases: MRT52, VIPL
• Gene name: lectin, mannose binding 2 like
• Alternate names: VIP36-like protein, LMAN2-like protein,
• Gene location: 2q11.2 (96740091: 96705928)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein belonging to the L-type lectin group of type 1 membrane proteins, which function in the mammalian early secretory pathway. These proteins contain luminal carbohydrate recognition domains, which display homology to leguminous le
• OMIM: 609552

Protein Summary

• Protein general information: Q9H0V9  
  • Name: VIP36 like protein (Lectin mannose binding 2 like) (LMAN2 like protein)
  • Length: 348  
  • Mass: 39711
  • Tissue specificity: Expressed in numerous tissues. Highest expression in skeletal muscle and kidney, intermediate levels in heart, liver and placenta, low levels in brain, thymus, spleen, small intestine and lung. {ECO
• Sequence:

  MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLM
  GNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDK
  FVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIM
  MDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLP
  EMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY

• Structural information:
  • Protein Domains: (49..27-)
    (/note="L-type-lectin-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00658"-)
  • Interpro: IPR013320  IPR005052  
  • Prosite: PS51328
  • STRING: ENSP00000366280
• Other Databases: GeneCards:  LMAN2L  Malacards:  LMAN2L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005537	mannose binding	IBA	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0007029	endoplasmic reticulum organization	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0000139	Golgi membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	NAS	cellular component
GO:0015031	protein transport	IMP	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006457	protein folding	NAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005537	mannose binding	TAS	molecular function

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Autosomal recessive mental retardation	KEGG:H00768
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)