• Gene id: 81559

Gene Summary

• Gene Symbol: TRIM11   Gene   UCSC   Ensembl
• Aliases: BIA1, RNF92
• Gene name: tripartite motif containing 11
• Alternate names: E3 ubiquitin-protein ligase TRIM11, RING finger protein 92, RING-type E3 ubiquitin transferase TRIM11, tripartite motif-containing protein 11,
• Gene location: 1q42.13 (196819729: 196832188)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cyto
• OMIM: 607868

Protein Summary

• Protein general information: Q96F44  
  • Name: E3 ubiquitin protein ligase TRIM11 (EC 2.3.2.27) (Protein BIA1) (RING finger protein 92) (RING type E3 ubiquitin transferase TRIM11) (Tripartite motif containing protein 11)
  • Length: 468  
  • Mass: 52774
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELSPQRNLRPNRPLAKMA
  EMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEHWAHRVRPLQDAAEDLKAKLEKSLEHLRKQM
  QDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHL
  AELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTANPEL
  ILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVCRENVNRKEKGELSAGN
  GFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSATDGSLLFIFPEIPFSGTLRPLFSPLSSSPT
  PMTICRPKGGSGDTLAPQ

• Structural information:
  • Protein Domains: (268..46-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021
  • STRING: ENSP00000284551
• Other Databases: GeneCards:  TRIM11  Malacards:  TRIM11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0045087	innate immune response	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1902187	negative regulation of viral release from host cell	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0050768	negative regulation of neurogenesis	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0032897	negative regulation of viral transcription	IEA	biological process
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0046598	positive regulation of viral entry into host cell	IEA	biological process
GO:0046597	negative regulation of viral entry into host cell	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0032897	negative regulation of viral transcription	IDA	biological process
GO:1902187	negative regulation of viral release from host cell	IDA	biological process
GO:0046597	negative regulation of viral entry into host cell	IMP	biological process
GO:1902187	negative regulation of viral release from host cell	IMP	biological process
GO:0046598	positive regulation of viral entry into host cell	IMP	biological process
GO:0045087	innate immune response	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq