• Gene id: 81556

Gene Summary

• Gene Symbol: INTS14   Gene   UCSC   Ensembl
• Aliases: C15orf44, VWA9
• Gene name: integrator complex subunit 14
• Alternate names: integrator complex subunit 14, UPF0464 protein C15orf44, von Willebrand factor A domain containing 9, von Willebrand factor A domain-containing protein 9,
• Gene location: 15q22.31 (65611130: 65578777)     Exons: 12     NC_000015.10
• OMIM: 0

Protein Summary

• Protein general information: Q96SY0  
  • Name: Integrator complex subunit 14 (von Willebrand factor A domain containing protein 9)
  • Length: 518  
  • Mass: 57471
  • Tissue specificity: Strongly expressed in numerous cancer cells compared with their non-cancerous counterparts (lung, prostate, colon, stomach and skin). {ECO
• Sequence:

  MPTVVVMDVSLSMTRPVSIEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLWELMVPFTRDYNTLQE
  ALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLGIGRGSLRHSLATQNQRSESNRFPLPFPFPS
  KLYIMCMANLEELQSTDSLECLERLIDLNNGEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADV
  QVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSAN
  QIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWHGMLYSQADSKKKSNLMMSLFEPGPEPLPWLGKMAQLGPISDA
  KENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKILRNARKLPEKTQTFYKELNRLRKAALAFGFL
  DLLKGVADMLERECTLLPETAHPDAAFQLTHAAQQLKLASTGTSEYAAYDQNITPLHTDFSGSSTERI

• Structural information:
  • Protein Domains: (2..20-)
    (/note="VWFA"-)
  • Interpro: IPR039841  IPR002035  IPR036465  
  • STRING: ENSP00000408429
• Other Databases: GeneCards:  INTS14  Malacards:  INTS14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034472	snRNA 3'-end processing	IBA	biological process
GO:0032039	integrator complex	IBA	cellular component
GO:0032039	integrator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)