• Gene id: 81555

Gene Summary

• Gene Symbol: YIPF5   Gene   UCSC   Ensembl
• Aliases: FinGER5, SB140, SMAP-5, SMAP5, YIP1A
• Gene name: Yip1 domain family member 5
• Alternate names: protein YIPF5, YIP1 family member 5, YPT-interacting protein 1 A, five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, golgi membrane protein SB140, smooth muscle cell associated protein 5,
• Gene location: 5q31.3 (144170658: 144158161)     Exons: 6     NC_000005.10
• OMIM: 611483

Protein Summary

• Protein general information: Q969M3  
  • Name: Protein YIPF5 (Five pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5) (Smooth muscle cell associated protein 5) (SMAP 5) (YIP1 family member 5) (YPT interacting protein 1 A)
  • Length: 257  
  • Mass: 27989
  • Tissue specificity: Ubiquitously expressed. Highly expressed in coronary smooth muscles. {ECO
• Sequence:

  MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTP
  ASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFG
  YVYGISAIGCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASK
  IFISALAMEGQQLLVAYPCALLYGVFALISVF

• Structural information:
  • Interpro: IPR006977  
  • STRING: ENSP00000274496
• Other Databases: GeneCards:  YIPF5  Malacards:  YIPF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060628	regulation of ER to Golgi vesicle-mediated transport	IEA	biological process
GO:0030134	COPII-coated ER to Golgi transport vesicle	IEA	cellular component
GO:0042175	nuclear outer membrane-endoplasmic reticulum membrane network	IEA	cellular component
GO:0070971	endoplasmic reticulum exit site	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881