• Gene id: 81552

Gene Summary

• Gene Symbol: VOPP1   Gene   UCSC   Ensembl
• Aliases: ECOP, GASP, WBP1L2
• Gene name: VOPP1 WW domain binding protein
• Alternate names: vesicular, overexpressed in cancer, prosurvival protein 1, EGFR-coamplified and overexpressed protein, Glioblastoma-amplified secreted protein, VOPP1, WBP1/VOPP1 family member, hypothetical protein DKFZp564K0822, putative NF-kappa-B-activating protein 055N,
• Gene location: 7p11.2 (55572501: 55434405)     Exons: 15     NC_000007.14
• OMIM: 613595

Protein Summary

• Protein general information: Q96AW1  
  • Name: Vesicular, overexpressed in cancer, prosurvival protein 1 (EGFR coamplified and overexpressed protein) (ECop) (Glioblastoma amplified secreted protein) (Putative NF kappa B activating protein 055N)
  • Length: 172  
  • Mass: 19224
  • Tissue specificity: Widely expressed with highest levels in thymus and ovary. {ECO
• Sequence:

  MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMGVLFCC
  GAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVA
  CPPPPAYCNTPPPPYEQVVKAK

• Structural information:
  • Interpro: IPR026229  
  • STRING: ENSP00000285279
• Other Databases: GeneCards:  VOPP1  Malacards:  VOPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031301	integral component of organelle membrane	IBA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0031301	integral component of organelle membrane	IDA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IDA	cellular component
GO:0031301	integral component of organelle membrane	IBA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0031301	integral component of organelle membrane	IDA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray