• Gene id: 81544

Gene Summary

• Gene Symbol: GDPD5   Gene   UCSC   Ensembl
• Aliases: GDE2, PP1665
• Gene name: glycerophosphodiester phosphodiesterase domain containing 5
• Alternate names: glycerophosphodiester phosphodiesterase domain-containing protein 5, glycerophosphodiester phosphodiesterase 2,
• Gene location: 11q13.4-q13.5 (75525940: 75434639)     Exons: 5     NC_000011.10
• Gene summary(Entrez): Glycerophosphodiester phosphodiesterases (GDPDs; EC 3.1.4.46), such as GDPD5, are involved in glycerol metabolism (Lang et al., 2008 [PubMed 17578682]).[supplied by OMIM, Jan 2010]
• OMIM: 609632

Protein Summary

• Protein general information: Q8WTR4  
  • Name: Glycerophosphodiester phosphodiesterase domain containing protein 5 (EC 3.1.4.11) (Glycerophosphodiester phosphodiesterase 2)
  • Length: 605  
  • Mass: 68586
• Sequence:

  MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLYFWWEVHNDYDEFNWY
  LYNRMGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNLHWLHKIGLVVILASTVVAMSAVAQLWEDEW
  EVLLISLQGTAPFLHVGAVAAVTMLSWIVAGQFARAERTSSQVTILCTFFTVVFALYLAPLTISSPCIMEKKDLG
  PKPALIGHRGAPMLAPEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASML
  NWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAKGNATLLLNLRDPPREHPYRSSFINV
  TLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVASLRRGHIQRLNLRYTQVSRQELRDYASWNLS
  VNLYTVNAPWLFSLLWCAGVPSVTSDNSHALSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGI
  RSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLI
  ERSGR

• Structural information:
  • Protein Domains: (228..48-)
    (/note="GP-PDE"-)
  • Interpro: IPR030395  IPR017946  
  • Prosite: PS51704
  • STRING: ENSP00000337972
• Other Databases: GeneCards:  GDPD5  Malacards:  GDPD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0004435	phosphatidylinositol phospholipase C activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021522	spinal cord motor neuron differentiation	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IEA	biological process
GO:0045787	positive regulation of cell cycle	IEA	biological process
GO:0047389	glycerophosphocholine phosphodiesterase activity	IEA	molecular function
GO:0097038	perinuclear endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0021895	cerebral cortex neuron differentiation	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0048505	regulation of timing of cell differentiation	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray