• Gene id: 81543

Gene Summary

• Gene Symbol: LRRC3   Gene   UCSC   Ensembl
• Aliases: C21orf102, C21orf30, LRRC3DN
• Gene name: leucine rich repeat containing 3
• Alternate names: leucine-rich repeat-containing protein 3, LRRC3 downstream neighbor (non-protein coding), intronless long ORF, AL117578,
• Gene location: 21q22.3 (44455509: 44462195)     Exons: 2     NC_000021.9
• OMIM: 610752

Protein Summary

• Protein general information: Q9BY71  
  • Name: Leucine rich repeat containing protein 3
  • Length: 257  
  • Mass: 28108
  • Tissue specificity: Widely expressed; detected in testis, lung, small intestine, breast, brain, heart, bone marrow, placenta, colon, fetal brain, liver, fetal liver, thymus, salivary gland, spinal cord, spleen, trachea and adrenal gland.
• Sequence:

  MGTVRPPRPSLLLVSTRESCLFLLFCLHLGAACPQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANK
  ISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCE
  CALQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDVAMLVTMFGWFAMVIAYVVYY
  VRHNQEDARRHLEYLKSLPSAPASKDPIGPGP

• Structural information:
  • Protein Domains: (33..6-)
    (/note="LRRNT"-)
  • Interpro: IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • STRING: ENSP00000291592
• Other Databases: GeneCards:  LRRC3  Malacards:  LRRC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R