• Gene id: 8153

Gene Summary

• Gene Symbol: RND2   Gene   UCSC   Ensembl
• Aliases: ARHN, RHO7, RhoN
• Gene name: Rho family GTPase 2
• Alternate names: rho-related GTP-binding protein RhoN, CTD-3199J23.4, GTP-binding protein Rho7, ras homolog gene family, member N, rho-related GTP-binding protein Rho7,
• Gene location: 17q21.31 (48120989: 48142671)     Exons: 11     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neu
• OMIM: 601555

Protein Summary

• Protein general information: P52198  
  • Name: Rho related GTP binding protein RhoN (Rho family GTPase 2) (Rho related GTP binding protein Rho7) (Rnd2)
  • Length: 227  
  • Mass: 25369
  • Tissue specificity: Highly expressed in testis.
• Sequence:

  MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDNVRPLA
  YPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLA
  KQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCN
  LM

• Structural information:
  • Interpro: IPR027417  IPR041842  IPR005225  IPR001806  IPR003578  
  • Prosite: PS51420
  • CDD: cd04173
  • STRING: ENSP00000466680
• Other Databases: GeneCards:  RND2  Malacards:  RND2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0003924	GTPase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048672	positive regulation of collateral sprouting	IEA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0005769	early endosome	IEA	cellular component
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R