• Gene id: 81501

Gene Summary

• Gene Symbol: DCSTAMP   Gene   UCSC   Ensembl
• Aliases: FIND, TM7SF4, hDC-STAMP
• Gene name: dendrocyte expressed seven transmembrane protein
• Alternate names: dendritic cell-specific transmembrane protein, DC-specific transmembrane protein, Dendritic cells (DC)-specific transmembrane protein, IL-4-induced protein, IL-Four (IL-4) induced, IL-Four INDuced, IL-four-induced protein, transmembrane 7 superfamily member 4,
• Gene location: 8q22.3 (104339086: 104356873)     Exons: 6     NC_000008.11
• Gene summary(Entrez): This gene encodes a seven-pass transmembrane protein that is primarily expressed in dendritic cells. The encoded protein is involved in a range of immunological functions carried out by dendritic cells. This protein plays a role in osteoclastogenesis and
• OMIM: 614085

Protein Summary

• Protein general information: Q9H295  
  • Name: Dendritic cell specific transmembrane protein (DC STAMP) (hDC STAMP) (Dendrocyte expressed seven transmembrane protein) (IL four induced protein) (FIND) (Transmembrane 7 superfamily member 4)
  • Length: 470  
  • Mass: 53393
  • Tissue specificity: Preferentially expressed by dendritic cells (DCs). Detected in both immature and mature DCs. Highly expressed in lymph nodes, lung, kidney and liver. Expressed at lower levels in pancreas, bone marrow, spleen, leukocytes, in freshly is
• Sequence:

  MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIAAAASWIITCVLLCCS
  KHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW
  IYGLATPLSVFDDLVSWNQTLAVSLFSPSHVLEAQLNDSKGEVLSVLYQMATTTEVLSSLGQKLLAFAGLSLVLL
  GTGLFMKRFLGPCGWKYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERKNLGLFFLPI
  LIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDIIHDSSFNISVFEPNCIPKPKFLLSE
  TWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYLHAKLLKKRSKQPLGEVKRRLSLYLTKIHFW
  LPVLKMIRKKQMDMASADKS

• Structural information:
  • Interpro: IPR012858  
  • STRING: ENSP00000297581
• Other Databases: GeneCards:  DCSTAMP  Malacards:  DCSTAMP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0071353	cellular response to interleukin-4	IDA	biological process
GO:0072675	osteoclast fusion	ISS	biological process
GO:0071356	cellular response to tumor necrosis factor	ISS	biological process
GO:0061025	membrane fusion	ISS	biological process
GO:0045780	positive regulation of bone resorption	ISS	biological process
GO:0045657	positive regulation of monocyte differentiation	ISS	biological process
GO:0030308	negative regulation of cell growth	ISS	biological process
GO:0043011	myeloid dendritic cell differentiation	ISS	biological process
GO:0036006	cellular response to macrophage colony-stimulating factor stimulus	ISS	biological process
GO:0034241	positive regulation of macrophage fusion	ISS	biological process
GO:0010008	endosome membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0072675	osteoclast fusion	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0061025	membrane fusion	IEA	biological process
GO:0045780	positive regulation of bone resorption	IEA	biological process
GO:0045657	positive regulation of monocyte differentiation	IEA	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0043011	myeloid dendritic cell differentiation	IEA	biological process
GO:0036006	cellular response to macrophage colony-stimulating factor stimulus	IEA	biological process
GO:0034241	positive regulation of macrophage fusion	IEA	biological process
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0010008	endosome membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0030316	osteoclast differentiation	ISS	biological process
GO:0016021	integral component of membrane	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq