• Gene id: 81488

Gene Summary

• Gene Symbol: POLR2M   Gene   UCSC   Ensembl
• Aliases: GCOM1, GRINL1A, Gdown, Gdown1
• Gene name: RNA polymerase II subunit M
• Alternate names: protein GRINL1A, DNA-directed RNA polymerase II subunit M, isoforms 4/5, GRINL1A downstream protein Gdown4, glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A, polymerase (RNA) II (DNA directed) polypeptide M, polymerase (RNA) II subunit M, protein GR,
• Gene location: 15q21.3 (57706520: 57717556)     Exons: 4     NC_000015.10
• Gene summary(Entrez): This gene encodes a subunit of a specific form of RNA polymerase II termed Pol II(G). The encoded protein may act as a negative regulator of transcriptional activation by the Mediator complex. Alternative splicing results in multiple transcript variants.
• OMIM: 600684

Protein Summary

• Protein general information: P0CAP2  
  • Name: DNA directed RNA polymerase II subunit GRINL1A (DNA directed RNA polymerase II subunit M) (Glutamate receptor like protein 1A)
  • Length: 368  
  • Mass: 41740
  • Tissue specificity: Detected in adult an fetal brain. Detected in heart, kidney, skeletal muscle, small intestine, lung, prostate and testis. {ECO
• Sequence:

  MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRRKSELF
  NPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGDEETSEVEYTV
  NKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGT
  EKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRRDKQHLDDITAARLLPLHHMP
  TQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDEDDDWSSDEF

• Structural information:
  • Interpro: IPR026213  
  • PDB: 6DRD
  • PDBsum: 6DRD
  • DIP: 61933
  • STRING: ENSP00000299638
• Other Databases: GeneCards:  POLR2M  Malacards:  POLR2M
• Protein general information: Q6EEV4  
  
  Name: DNA directed RNA polymerase II subunit GRINL1A, isoforms 4/5 (DNA directed RNA polymerase II subunit M, isoforms 4/5)
  
  Length: 148  Mass: 15131
• Sequence: MATPARAPESPPSADPALVAGPAEEAECPPPRQPQPAQNVLAAPRLRAPSSRGLGAAEFGGAAGNVEAPGETFAQ
  RVSWGPAESPPGSFSSSSLGAPLPSRTLFPSLEGDFDSVTFASVLRASGRRACCGRAVPLPGQKIHLQIARQR
• Other Databases: GeneCards:  POLR2M  Malacards:  POLR2M

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005665	RNA polymerase II, core complex	IPI	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0051685	maintenance of ER location	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0032774	RNA biosynthetic process	IEA	biological process
GO:0016591	RNA polymerase II, holoenzyme	IDA	cellular component
GO:0016591	RNA polymerase II, holoenzyme	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IEA	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray