• Gene id: 8140

Gene Summary

• Gene Symbol: SLC7A5   Gene   UCSC   Ensembl
• Aliases: 4F2LC, CD98, D16S469E, E16, LAT1, MPE16
• Gene name: solute carrier family 7 member 5
• Alternate names: large neutral amino acids transporter small subunit 1, 4F2 light chain, CD98 light chain, L-type amino acid transporter 1, integral membrane protein E16, sodium-independent neutral amino acid transporter LAT1, solute carrier family 7 (amino acid transport,
• Gene location: 16q24.2 (87869498: 87830015)     Exons: 11     NC_000016.10
• OMIM: 600182

Protein Summary

• Protein general information: Q01650  
  • Name: Large neutral amino acids transporter small subunit 1 (4F2 light chain) (4F2 LC) (4F2LC) (CD98 light chain) (Integral membrane protein E16) (L type amino acid transporter 1) (hLAT1) (Solute carrier family 7 member 5) (y+ system cationic amino acid transpo
  • Length: 507  
  • Mass: 55,010
• Sequence:

  MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGV
  LKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVAL
  VFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIGKGDVS
  NLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTL
  STEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVP
  SLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVS
  FWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET

• Structural information:
  • Interpro: IPR002293  IPR004760  
  • STRING: ENSP00000261622
• Other Databases: GeneCards:  SLC7A5  Malacards:  SLC7A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006520	cellular amino acid metabolic process	TAS	biological process
GO:0006810	transport	TAS	biological process
GO:0006865	amino acid transport	TAS	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0015171	amino acid transmembrane transporter activity	ISS	molecular function
GO:0015175	neutral amino acid transmembrane transporter activity	TAS	molecular function
GO:0015179	L-amino acid transmembrane transporter activity	IBA	molecular function
GO:0015297	antiporter activity	IBA	molecular function
GO:0015804	neutral amino acid transport	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0042605	peptide antigen binding	ISS	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1902475	L-alpha-amino acid transmembrane transport	IEA	biological process
GO:0003333	amino acid transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006520	cellular amino acid metabolic process	TAS	biological process
GO:0006810	transport	IEA	biological process
GO:0006810	transport	TAS	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0006865	amino acid transport	TAS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0015171	amino acid transmembrane transporter activity	IEA	molecular function
GO:0015171	amino acid transmembrane transporter activity	ISS	molecular function
GO:0015175	neutral amino acid transmembrane transporter activity	TAS	molecular function
GO:0015179	L-amino acid transmembrane transporter activity	IEA	molecular function
GO:0015179	L-amino acid transmembrane transporter activity	IBA	molecular function
GO:0015297	antiporter activity	IBA	molecular function
GO:0015804	neutral amino acid transport	ISS	biological process
GO:0015807	L-amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0042605	peptide antigen binding	ISS	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1902475	L-alpha-amino acid transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006520	cellular amino acid metabolic process	TAS	biological process
GO:0006810	transport	TAS	biological process
GO:0006865	amino acid transport	TAS	biological process
GO:0015171	amino acid transmembrane transporter activity	ISS	molecular function
GO:0015175	neutral amino acid transmembrane transporter activity	TAS	molecular function
GO:0015179	L-amino acid transmembrane transporter activity	IBA	molecular function
GO:0015297	antiporter activity	IBA	molecular function
GO:0015804	neutral amino acid transport	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0042605	peptide antigen binding	ISS	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway
hsa05230	Central carbon metabolism in cancer

Diseases

Associated diseases	References
Male factor infertility	MIK: 24597237
Unexplained infertility	MIK: 24597237
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 24597237

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24597237	Unexplained infertility			20 normozoospermic infertile men	Male infertility	CD52 CD69 CD98 fMLP HI307 and 80280
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq