• Gene id: 814

Gene Summary

• Gene Symbol: CAMK4   Gene   UCSC   Ensembl
• Aliases: CaMK IV, CaMK-GR, caMK
• Gene name: calcium/calmodulin dependent protein kinase IV
• Alternate names: calcium/calmodulin-dependent protein kinase type IV, CAM kinase IV, CAM kinase- GR, brain Ca(2+)-calmodulin-dependent protein kinase type IV, brain Ca++-calmodulin-dependent protein kinase type IV, calcium/calmodulin-dependent protein kinase type IV catal,
• Gene location: 5q22.1 (111223652: 111498502)     Exons: 13     NC_000005.10
• Gene summary(Entrez): The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has be
• OMIM: 114080

Protein Summary

• Protein general information: Q16566  
  • Name: Calcium/calmodulin dependent protein kinase type IV (CaMK IV) (EC 2.7.11.17) (CaM kinase GR)
  • Length: 473  
  • Mass: 51,926
• Sequence:

  MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQKPYALK
  VLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILE
  AVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMW
  SVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
  TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEG
  EKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAP
  REGQGSSAVGFEVPQQDVILPEY

• Structural information:
  • Protein Domains: Protein (46-300)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2W4O
  • PDBsum: 2W4O
  • DIP: 41997
  • STRING: ENSP00000282356
• Other Databases: GeneCards:  CAMK4  Malacards:  CAMK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002250	adaptive immune response	IEA	biological process
GO:0004683	calmodulin-dependent protein kinase activity	IDA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007616	long-term memory	IGI	biological process
GO:0009931	calcium-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0033081	regulation of T cell differentiation in thymus	TAS	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0043011	myeloid dendritic cell differentiation	IMP	biological process
GO:0045670	regulation of osteoclast differentiation	TAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0002372	myeloid dendritic cell cytokine production	IMP	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0002250	adaptive immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IDA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007616	long-term memory	IGI	biological process
GO:0009931	calcium-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0033081	regulation of T cell differentiation in thymus	TAS	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0043011	myeloid dendritic cell differentiation	IMP	biological process
GO:0045670	regulation of osteoclast differentiation	TAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0002372	myeloid dendritic cell cytokine production	IMP	biological process
GO:0004683	calmodulin-dependent protein kinase activity	IDA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007616	long-term memory	IGI	biological process
GO:0009931	calcium-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0033081	regulation of T cell differentiation in thymus	TAS	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0043011	myeloid dendritic cell differentiation	IMP	biological process
GO:0045670	regulation of osteoclast differentiation	TAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0002372	myeloid dendritic cell cytokine production	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway
hsa04024	cAMP signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04925	Aldosterone synthesis and secretion
hsa04725	Cholinergic synapse
hsa04720	Long-term potentiation
hsa04722	Neurotrophin signaling pathway
hsa04380	Osteoclast differentiation
hsa04211	Longevity regulating pathway
hsa05214	Glioma
hsa05031	Amphetamine addiction
hsa05034	Alcoholism

Diseases

Associated diseases	References
Blood pressure	GAD: 17903302
Azoospermia	GAD: 20378615
Oligoasthenoteratozoospermia	MIK: 22897820
Male factor infertility	MIK: 22897820
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Male infertility	MIK: 10932193
Oligoasthenoteratozoospermia (OAT)	MIK: 22897820
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22897820	Oligoasthenoteratozoospermia (OAT), male infertility	g.150264_66delGCG	Indian	551 (283 infertile men, 268 fertile men)	Male infertility	CAMK4
10932193	Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R