• Gene id: 813

Gene Summary

• Gene Symbol: CALU   Gene   UCSC   Ensembl
• Gene name: calumenin
• Alternate names: calumenin, IEF SSP 9302, crocalbin-like protein, multiple EF-hand protein,
• Gene location: 7q32.1 (59933768: 59948679)     Exons: 6     NC_000020.11
• Gene summary(Entrez): The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include ret
• OMIM: 603420

Protein Summary

• Protein general information: O43852  
  • Name: Calumenin (Crocalbin) (IEF SSP 9302)
  • Length: 315  
  • Mass: 37107
  • Tissue specificity: Ubiquitously expressed. Expressed at high levels in heart, placenta and skeletal muscle, at lower levels in lung, kidney and pancreas and at very low levels in brain and liver.
• Sequence:

  MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGK
  IVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYK
  QMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTD
  EPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
  QATDFGEALVRHDEF

• Structural information:
  • Protein Domains: (68..10-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (104..13-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (151..18-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU-)
  • Interpro: IPR027239  IPR011992  IPR018247  IPR002048  
  • Prosite: PS00018 PS50222
  • STRING: ENSP00000438248
• Other Databases: GeneCards:  CALU  Malacards:  CALU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0033018	sarcoplasmic reticulum lumen	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
colorectal carcinoma	PMID:18776587
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray