• Gene id: 8128

Gene Summary

• Gene Symbol: ST8SIA2   Gene   UCSC   Ensembl
• Aliases: HsT19690, SIAT8-B, SIAT8B, ST8SIA-II, ST8SiaII, STX
• Gene name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
• Alternate names: alpha-2,8-sialyltransferase 8B, ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 2, alpha-2,8-sialyltransferase 8B 1, sialyltransferase 8 (alpha-2, 8-sialytransferase) B, sialyltransferase 8B, sialyltransferase St8Sia II, sialyltransferase X,
• Gene location: 15q26.1 (92393880: 92468727)     Exons: 2     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be
• OMIM: 602546

Protein Summary

• Protein general information: Q92186  
  • Name: Alpha 2,8 sialyltransferase 8B (EC 2.4.99. ) (Sialyltransferase 8B) (SIAT8 B) (Sialyltransferase St8Sia II) (ST8SiaII) (Sialyltransferase X) (STX)
  • Length: 375  
  • Mass: 42430
  • Tissue specificity: Highly expressed in fetal brain, kidney and heart and to a much lesser extent in adult heart and thymus.
• Sequence:

  MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESI
  KHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLK
  NKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREK
  LLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMY
  TLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000268164
• Other Databases: GeneCards:  ST8SIA2  Malacards:  ST8SIA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006491	N-glycan processing	IBA	biological process
GO:0006486	protein glycosylation	IBA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0007399	nervous system development	TAS	biological process
GO:0006464	cellular protein modification process	TAS	biological process
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA	molecular function
GO:0055037	recycling endosome	IEA	cellular component
GO:0033691	sialic acid binding	IC	molecular function
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IDA	molecular function
GO:0001574	ganglioside biosynthetic process	IDA	biological process
GO:0006486	protein glycosylation	IDA	biological process
GO:0006491	N-glycan processing	IDA	biological process
GO:0009311	oligosaccharide metabolic process	IDA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq