• Gene id: 8125

Gene Summary

• Gene Symbol: ANP32A   Gene   UCSC   Ensembl
• Aliases: C15orf1, HPPCn, I1PP2A, LANP, MAPM, PHAP1, PHAPI, PP32
• Gene name: acidic nuclear phosphoprotein 32 family member A
• Alternate names: acidic leucine-rich nuclear phosphoprotein 32 family member A, acidic (leucine-rich) nuclear phosphoprotein 32 family, member A, acidic nuclear phosphoprotein pp32, cerebellar leucine rich acidic nuclear protein, epididymis secretory sperm binding protein, hep,
• Gene location: 15q23 (68820894: 68778534)     Exons: 7     NC_000015.10
• OMIM: 600832

Protein Summary

• Protein general information: P39687  
  • Name: Acidic leucine rich nuclear phosphoprotein 32 family member A (Acidic nuclear phosphoprotein pp32) (pp32) (Leucine rich acidic nuclear protein) (LANP) (Mapmodulin) (Potent heat stable protein phosphatase 2A inhibitor I1PP2A) (Putative HLA DR associated pr
  • Length: 249  
  • Mass: 28585
  • Tissue specificity: Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate
• Sequence:

  MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNR
  VSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDR
  DDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDE
  EELGEEERGQKRKREPEDEGEDDD

• Structural information:
  • Protein Domains: (123..16-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR032675  IPR003603  
  • Prosite: PS51450
  • PDB: 2JE0 2JE1 4XOS
  • PDBsum: 2JE0 2JE1 4XOS
  • STRING: ENSP00000417864
• Other Databases: GeneCards:  ANP32A  Malacards:  ANP32A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042393	histone binding	IBA	molecular function
GO:0048471	perinuclear region of cytoplasm	IBA	cellular component
GO:0006913	nucleocytoplasmic transport	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006913	nucleocytoplasmic transport	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0006913	nucleocytoplasmic transport	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R