Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 8115
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol TCL1A   Gene   UCSC   Ensembl
Aliases TCL1
Gene name TCL1 family AKT coactivator A
Alternate names T-cell leukemia/lymphoma protein 1A, T cell leukemia/lymphoma 1A, T-cell lymphoma-1, oncogene TCL-1, oncogene TCL1, protein p14 TCL1,
Gene location 14q32.13 (95714154: 95694159)     Exons: 6     NC_000014.9
Gene summary(Entrez) Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM
OMIM 606231

Protein Summary
Protein general information P56279  

Name: T cell leukemia/lymphoma protein 1A (Oncogene TCL 1) (Oncogene TCL1) (Protein p14 TCL1)

Length: 114  Mass: 13460

Tissue specificity: Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation.

Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIM
WQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Structural information
Interpro:  IPR004832  IPR036672  

PDB:  		 1JSG
PDBsum:   1JSG

DIP:  
60787
MINT:  
STRING:   ENSP00000385036
Other Databases GeneCards:  TCL1A  Malacards:  TCL1A

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0043539 protein serine/threonine
kinase activator activity
 IBA molecular function
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
 IBA biological process
GO:0005515 protein binding
 IPI molecular function
GO:0043539 protein serine/threonine
kinase activator activity
 IEA molecular function
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0043231 intracellular membrane-bo
unded organelle
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0007275 multicellular organism de
velopment
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0043231 intracellular membrane-bo
unded organelle
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0010918 positive regulation of mi
tochondrial membrane pote
ntial
 IDA biological process
GO:0071356 cellular response to tumo
r necrosis factor
 IDA biological process
GO:0008284 positive regulation of ce
ll population proliferati
on
 IDA biological process
GO:0031334 positive regulation of pr
otein-containing complex
assembly
 IDA biological process
GO:0042802 identical protein binding
 IDA molecular function
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
 IDA biological process
GO:0043066 negative regulation of ap
optotic process
 IDA biological process
GO:0043539 protein serine/threonine
kinase activator activity
 IMP molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0032991 protein-containing comple
x
 IMP cellular component
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
 IMP biological process
GO:0043539 protein serine/threonine
kinase activator activity
 IBA molecular function
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
 IBA biological process
GO:0005515 protein binding
 IPI molecular function
GO:0043539 protein serine/threonine
kinase activator activity
 IEA molecular function
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0043231 intracellular membrane-bo
unded organelle
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0007275 multicellular organism de
velopment
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0043231 intracellular membrane-bo
unded organelle
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0010918 positive regulation of mi
tochondrial membrane pote
ntial
 IDA biological process
GO:0071356 cellular response to tumo
r necrosis factor
 IDA biological process
GO:0008284 positive regulation of ce
ll population proliferati
on
 IDA biological process
GO:0031334 positive regulation of pr
otein-containing complex
assembly
 IDA biological process
GO:0042802 identical protein binding
 IDA molecular function
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
 IDA biological process
GO:0043066 negative regulation of ap
optotic process
 IDA biological process
GO:0043539 protein serine/threonine
kinase activator activity
 IMP molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0019901 protein kinase binding
 IPI molecular function
GO:0032991 protein-containing comple
x
 IMP cellular component
GO:0033138 positive regulation of pe
ptidyl-serine phosphoryla
tion
 IMP biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
T-cell leukemia PMID:10077617
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
31037746 Spermatoge
nic defect
s
28 men with az
oospermia
 Male infertility Microarray
 Show abstract