• Gene id: 8111

Gene Summary

• Gene Symbol: GPR68   Gene   UCSC   Ensembl
• Aliases: AI2A6, GPR12A, OGR1
• Gene name: G protein-coupled receptor 68
• Alternate names: ovarian cancer G-protein coupled receptor 1, ovarian cancer G protein-coupled receptor, 1, sphingosylphosphorylcholine receptor,
• Gene location: 14q32.11 (91264580: 91232531)     Exons: 10     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a G protein-coupled receptor for sphingosylphosphorylcholine. The encoded protein is a proton-sensing receptor, inactive at pH 7.8 but active at pH 6.8. Mutations in this gene are a cause of amelogenesis imperfecta. [pr
• OMIM: 109091

Protein Summary

• Protein general information: Q15743  
  • Name: Ovarian cancer G protein coupled receptor 1 (OGR 1) (G protein coupled receptor 68) (GPR12A) (Sphingosylphosphorylcholine receptor)
  • Length: 365  
  • Mass: 41077
  • Tissue specificity: Found at low level in a wide range of tissues, but significantly expressed in lung, kidney, bone and nervous system. {ECO
• Sequence:

  MGNITADNSSMSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTVADLFYICSLP
  FWLQYVLQHDNWSHGDLSCQVCGILLYENIYISVGFLCCISVDRYLAVAHPFRFHQFRTLKAAVGVSVVIWAKEL
  LTSIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLLASYQGILRAVRRSHGTQKSRKDQ
  IQRLVLSTVVIFLACFLPYHVLLLVRSVWEASCDFAKGVFNAYHFSLLLTSFNCVADPVLYCFVSETTHRDLARL
  RGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR005389  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000434045
• Other Databases: GeneCards:  GPR68  Malacards:  GPR68

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071467	cellular response to pH	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0045656	negative regulation of monocyte differentiation	IEA	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:2001206	positive regulation of osteoclast development	IEA	biological process
GO:0071467	cellular response to pH	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Amelogenesis imperfecta	KEGG:H00615
Amelogenesis imperfecta	KEGG:H00615
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq