• Gene id: 8106

Gene Summary

• Gene Symbol: PABPN1   Gene   UCSC   Ensembl
• Aliases: OPMD, PAB2, PABII, PABP-2, PABP2
• Gene name: poly(A) binding protein nuclear 1
• Alternate names: polyadenylate-binding protein 2, poly(A) binding protein 2, poly(A) binding protein II,
• Gene location: 14q11.2 (23320187: 23326184)     Exons: 7     NC_000014.9
• Gene summary(Entrez): This gene encodes an abundant nuclear protein that binds with high affinity to nascent poly(A) tails. The protein is required for progressive and efficient polymerization of poly(A) tails at the 3' ends of eukaryotic transcripts and controls the size of t
• OMIM: 605266

Protein Summary

• Protein general information: Q86U42  
  • Name: Polyadenylate binding protein 2 (PABP 2) (Poly(A) binding protein 2) (Nuclear poly(A) binding protein 1) (Poly(A) binding protein II) (PABII) (Polyadenylate binding nuclear protein 1)
  • Length: 306  
  • Mass: 32749
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPP
  RPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMS
  PPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKES
  VRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT
  SWYSPY

• Structural information:
  • Protein Domains: (172..24-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR034911  IPR035979  IPR000504  
  • Prosite: PS50102
  • PDB: 3B4D 3B4M 3UCG
  • PDBsum: 3B4D 3B4M 3UCG
  • DIP: 37968
  • STRING: ENSP00000216727
• Other Databases: GeneCards:  PABPN1  Malacards:  PABPN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042405	nuclear inclusion body	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070063	RNA polymerase binding	ISS	molecular function
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904247	positive regulation of polynucleotide adenylyltransferase activity	ISS	biological process
GO:0000165	MAPK cascade	ISS	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:1904247	positive regulation of polynucleotide adenylyltransferase activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0006936	muscle contraction	TAS	biological process
GO:0006396	RNA processing	TAS	biological process
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0046778	modification by virus of host mRNA processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0070063	RNA polymerase binding	IEA	molecular function
GO:0042405	nuclear inclusion body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1904247	positive regulation of polynucleotide adenylyltransferase activity	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016973	poly(A)+ mRNA export from nucleus	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Oculopharyngeal muscular dystrophy	KEGG:H00704
Oculopharyngeal muscular dystrophy	KEGG:H00704
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881