• Gene id: 81035

Gene Summary

• Gene Symbol: COLEC12   Gene   UCSC   Ensembl
• Aliases: CLP1, NSR2, SCARA4, SRCL
• Gene name: collectin subfamily member 12
• Alternate names: collectin-12, collectin placenta protein 1, collectin sub-family member 12, hCL-P1, nurse cell scavenger receptor 2, scavenger receptor class A, member 4, scavenger receptor with C-type lectin,
• Gene location: 18p11.32 (50634880: 50692252)     Exons: 31     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor that displays several functions associated with host defense. It can bind to carboh
• OMIM: 607621

Protein Summary

• Protein general information: Q5KU26  
  • Name: Collectin 12 (Collectin placenta protein 1) (CL P1) (hCL P1) (Nurse cell scavenger receptor 2) (Scavenger receptor class A member 4) (Scavenger receptor with C type lectin)
  • Length: 742  
  • Mass: 81515
  • Tissue specificity: Expressed in perivascular macrophages. Expressed in plaques-surrounding reactive astrocytes and in perivascular astrocytes associated with cerebral amyloid angiopathy (CAA) in the temporal cortex of Alzheimer patient (at protein level)
• Sequence:

  MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVVEKMDNVTGGMETS
  RQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQ
  SQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQR
  SVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENI
  TTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTSNLNEVRTTCTDTL
  TKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVIMEEMKLVDSKHGQLIKNFTILQGPPGPRGP
  RGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGSSGD
  PGPPGPPGKEGLPGPQGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTP
  APEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVGRESHWIGLTDSEREN
  EWKWLDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDFQCEDVNNFICEKDRETVLSSAL

• Structural information:
  • Protein Domains: (443..47-)
    (/note="Collagen-like-1)
    (473..52-)
    (/note="Collagen-like-2)
    (530..58-)
    (/note="Collagen-like-3)
    (614..73-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR033989  IPR008160   IPR016187  
  • Prosite: PS00615 PS50041
  • CDD: cd03590
  • PDB: 2OX8
  • PDBsum: 2OX8
  • STRING: ENSP00000383115
• Other Databases: GeneCards:  COLEC12  Malacards:  COLEC12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038187	pattern recognition receptor activity	IBA	molecular function
GO:0030169	low-density lipoprotein particle binding	IBA	molecular function
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0006952	defense response	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005044	scavenger receptor activity	TAS	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005044	scavenger receptor activity	IDA	molecular function
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0038187	pattern recognition receptor activity	IDA	molecular function
GO:0042742	defense response to bacterium	IDA	biological process
GO:0006910	phagocytosis, recognition	IDA	biological process
GO:0071360	cellular response to exogenous dsRNA	IMP	NOT|biological process
GO:0034138	toll-like receptor 3 signaling pathway	IMP	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0060355	positive regulation of cell adhesion molecule production	IMP	biological process
GO:0005534	galactose binding	NAS	molecular function
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0009756	carbohydrate mediated signaling	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)