• Gene id: 81031

Gene Summary

• Gene Symbol: SLC2A10   Gene   UCSC   Ensembl
• Aliases: ATORS, ATS, GLUT10
• Gene name: solute carrier family 2 member 10
• Alternate names: solute carrier family 2, facilitated glucose transporter member 10, GLUT-10, glucose transporter type 10, solute carrier family 2 (facilitated glucose transporter), member 10,
• Gene location: 20q13.12 (46708357: 46736346)     Exons: 8     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the class III facilitative glucose transporter family. The encoded protein plays a role in regulation of glucose homeostasis. Mutations in this gene have been associated with arterial tortuosity syndrome.[provided by RefSeq,
• OMIM: 606145

Protein Summary

• Protein general information: O95528  
  • Name: Solute carrier family 2, facilitated glucose transporter member 10 (Glucose transporter type 10) (GLUT 10)
  • Length: 541  
  • Mass: 56911
  • Tissue specificity: Widely expressed; highest levels in liver and pancreas. {ECO
• Sequence:

  MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALLASLVGGFLIDCYGRK
  QAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACCIYVSELVGPRQRGVLVSLYEAGITVGILLS
  YALNYALAGTPWGWRHMFGWATAPAVLQSLSLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRAR
  DNMRGRTTVGLGLVLFQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL
  LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTNEDQREPILSTAKKTK
  PHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFVSAFSFGFGPVTWLVLSEIYPVEIRGRAFAF
  CNSFNWAANLFISLSFLDLIGTIGLSWTFLLYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQ
  NSTGIPYSRIEISAAS

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR003663  IPR005829  
  • Prosite: PS50850 PS00216
  • STRING: ENSP00000352216
• Other Databases: GeneCards:  SLC2A10  Malacards:  SLC2A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098708	glucose import across plasma membrane	IDA	biological process
GO:0055056	D-glucose transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	is active in
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0033300	dehydroascorbic acid transmembrane transporter activity	IDA	molecular function
GO:0070837	dehydroascorbic acid transport	IDA	biological process
GO:1902730	positive regulation of proteoglycan biosynthetic process	IMP	biological process
GO:1902729	negative regulation of proteoglycan biosynthetic process	IMP	biological process
GO:2001045	negative regulation of integrin-mediated signaling pathway	IMP	biological process
GO:1903053	regulation of extracellular matrix organization	IMP	biological process
GO:0045421	negative regulation of connective tissue growth factor production	IMP	biological process
GO:0045421	negative regulation of connective tissue growth factor production	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0045454	cell redox homeostasis	IMP	biological process
GO:0043588	skin development	IMP	biological process
GO:0015757	galactose transmembrane transport	TAS	biological process
GO:0005887	integral component of plasma membrane	RCA	cellular component
GO:0005887	integral component of plasma membrane	RCA	cellular component
GO:0060392	negative regulation of SMAD protein signal transduction	IMP	biological process
GO:0060840	artery development	IMP	biological process
GO:0060840	artery development	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0072498	embryonic skeletal joint development	IMP	biological process
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0046323	glucose import	IBA	biological process
GO:0005351	carbohydrate:proton symporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0008645	hexose transmembrane transport	TAS	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:1904659	glucose transmembrane transport	NAS	biological process
GO:0005351	carbohydrate:proton symporter activity	NAS	molecular function

Diseases

Associated diseases	References
Arterial tortuosity syndrome	KEGG:H00919
Arterial tortuosity syndrome	KEGG:H00919
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray