• Gene id: 81030

Gene Summary

• Gene Symbol: ZBP1   Gene   UCSC   Ensembl
• Aliases: C20orf183, DAI, DLM-1, DLM1
• Gene name: Z-DNA binding protein 1
• Alternate names: Z-DNA-binding protein 1, DNA-dependent activator of IRFs, tumor stroma and activated macrophage protein DLM-1,
• Gene location: 20q13.31 (57620479: 57603851)     Exons: 13     NC_000020.11
• Gene summary(Entrez): This gene encodes a Z-DNA binding protein. The encoded protein plays a role in the innate immune response by binding to foreign DNA and inducing type-I interferon production. Alternatively spliced transcript variants encoding multiple isoforms have been o
• OMIM: 606750

Protein Summary

• Protein general information: Q9H171  
  • Name: Z DNA binding protein 1 (Tumor stroma and activated macrophage protein DLM 1)
  • Length: 429  
  • Mass: 46343
  • Tissue specificity: Highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow and spleen. Expressed to a lesser extent in thymus, lung and liver.
• Sequence:

  MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEG
  EGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSR
  HLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNGPNSWISIANSEAIQIGHGNIITRQTVSREDGS
  AGPRHLPSMAPGDSSTWGTLVDPWGPQDIHMEQSILRRVQLGHSNEMRLHGVPSEGPAHIPPGSPPVSATAAGPE
  ASFEARIPSPGTHPEGEAAQRIHMKSCFLEDATIGNSNKMSISPGVAGPGGVAGSGEGEPGEDAGRRPADTQSRS
  HFPRDIGQPITPSHSKLTPKLETMTLGNRSHKAAEGSHYVDEASHEGSWWGGGI

• Structural information:
  • Interpro: IPR036388  IPR036390  IPR042371  IPR042361  
  • PDB: 2L4M 2LNB 3EYI 4KA4
  • PDBsum: 2L4M 2LNB 3EYI 4KA4
  • DIP: 44121
  • STRING: ENSP00000360215
• Other Databases: GeneCards:  ZBP1  Malacards:  ZBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051607	defense response to virus	IMP	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0050727	regulation of inflammatory response	ISS	biological process
GO:0060545	positive regulation of necroptotic process	IMP	biological process
GO:0003725	double-stranded RNA binding	ISS	molecular function
GO:2000659	regulation of interleukin-1-mediated signaling pathway	ISS	biological process
GO:0070269	pyroptosis	ISS	biological process
GO:0043065	positive regulation of apoptotic process	ISS	biological process
GO:0002218	activation of innate immune response	ISS	biological process
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032479	regulation of type I interferon production	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003692	left-handed Z-DNA binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04217	Necroptosis
hsa04623	Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)