• Gene id: 81029

Gene Summary

• Gene Symbol: WNT5B   Gene   UCSC   Ensembl
• Gene name: Wnt family member 5B
• Alternate names: protein Wnt-5b, WNT-5B protein, wingless-type MMTV integration site family, member 5B,
• Gene location: 12p13.33 (1529855: 1647212)     Exons: 13     NC_000012.12
• Gene summary(Entrez): The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
• OMIM: 114078

Protein Summary

• Protein general information: Q9H1J7  
  • Name: Protein Wnt 5b
  • Length: 359  
  • Mass: 40323
• Sequence:

  MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEG
  AKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELSTCGCSRTARPK
  DLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGS
  CSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
  GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK

• Structural information:
  • Interpro: IPR005817  IPR026537  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000380379
• Other Databases: GeneCards:  WNT5B  Malacards:  WNT5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0070062	extracellular exosome	TAS	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0042060	wound healing	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0070307	lens fiber cell development	ISS	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071300	cellular response to retinoic acid	ISS	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0002062	chondrocyte differentiation	IEP	biological process
GO:0045444	fat cell differentiation	NAS	biological process
GO:0005615	extracellular space	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa04360	Axon guidance
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
leiomyoma	PMID:15972578
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq