• Gene id: 8099

Gene Summary

• Gene Symbol: CDK2AP1   Gene   UCSC   Ensembl
• Aliases: DOC1, DORC1, ST19, doc-1, p12DOC-1
• Gene name: cyclin dependent kinase 2 associated protein 1
• Alternate names: cyclin-dependent kinase 2-associated protein 1, CDK2-associated protein 1, Deleted in oral cancer-1, deleted in oral cancer 1, putative oral cancer suppressor,
• Gene location: 12q24.31 (123272239: 123260969)     Exons: 8     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact wi
• OMIM: 609117

Protein Summary

• Protein general information: O14519  
  • Name: Cyclin dependent kinase 2 associated protein 1 (CDK2 associated protein 1) (Deleted in oral cancer 1) (DOC 1) (Putative oral cancer suppressor)
  • Length: 115  
  • Mass: 12365
• Sequence:

  MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGK
  EIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS

• Structural information:
  • Interpro: IPR017266  
  • PDB: 2KW6
  • PDBsum: 2KW6
  • STRING: ENSP00000261692
• Other Databases: GeneCards:  CDK2AP1  Malacards:  CDK2AP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0006261	DNA-dependent DNA replication	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq