• Gene id: 80895

Gene Summary

• Gene Symbol: ILKAP   Gene   UCSC   Ensembl
• Aliases: ILKAP2, ILKAP3, PP2C-DELTA, PPM1O
• Gene name: ILK associated serine/threonine phosphatase
• Alternate names: integrin-linked kinase-associated serine/threonine phosphatase 2C, integrin-linked kinase associated phosphatase, protein phosphatase 2c, delta isozyme, protein phosphatase, Mg2+/Mn2+ dependent 1O,
• Gene location: 2q37.3 (56520094: 56470402)     Exons: 18     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a protein serine/threonine phosphatase of the PP2C family. This protein can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through t

Protein Summary

• Protein general information: Q9H0C8  
  • Name: Integrin linked kinase associated serine/threonine phosphatase 2C (ILKAP) (EC 3.1.3.16)
  • Length: 392  
  • Mass: 42907
  • Tissue specificity: Widely expressed. Highest levels expressed in striated muscle. Much lower levels evident in various smooth muscle tissues. {ECO
• Sequence:

  MDLFGDLPEPERSPRPAAGKEAQKGPLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMVKTEGK
  GAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITEECRPPSSLITRVSYFAV
  FDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAV
  DNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKR
  CGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAV
  QRGSADNVTVMVVRIGH

• Structural information:
  • Protein Domains: (108..39-)
    (/note="PPM-type-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01082"-)
  • Interpro: IPR015655  IPR000222  IPR036457  IPR001932  
  • Prosite: PS01032 PS51746
  • CDD: cd00143
  • STRING: ENSP00000254654
• Other Databases: GeneCards:  ILKAP  Malacards:  ILKAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0004724	magnesium-dependent protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0043169	cation binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray