• Gene id: 8089

Gene Summary

• Gene Symbol: YEATS4   Gene   UCSC   Ensembl
• Aliases: 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9
• Gene name: YEATS domain containing 4
• Alternate names: YEATS domain-containing protein 4, NuMA binding protein 1, glioma-amplified sequence 41, nuBI1,
• Gene location: 12q15 (36090142: 36088255)     Exons: 3     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein migh
• OMIM: 602116

Protein Summary

• Protein general information: O95619  
  • Name: YEATS domain containing protein 4 (Glioma amplified sequence 41) (Gas41) (NuMA binding protein 1) (NuBI 1) (NuBI1)
  • Length: 227  
  • Mass: 26499
  • Tissue specificity: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO
• Sequence:

  MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYG
  NPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAM
  MQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAK
  DI

• Structural information:
  • Protein Domains: (22..12-)
    (/note="YEATS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00376"-)
  • Interpro: IPR038704  IPR005033  
  • Prosite: PS51037
  • PDB: 5VNA 5VNB 5XTZ 5Y8V
  • PDBsum: 5VNA 5VNB 5XTZ 5Y8V
  • STRING: ENSP00000247843
• Other Databases: GeneCards:  YEATS4  Malacards:  YEATS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0070577	lysine-acetylated histone binding	IDA	molecular function
GO:0140030	modification-dependent protein binding	IDA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0043968	histone H2A acetylation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0016363	nuclear matrix	NAS	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0000278	mitotic cell cycle	NAS	biological process
GO:0005200	structural constituent of cytoskeleton	NAS	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray