Male Infertility Database

Search Result

Gene id

80863

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

PRRT1 Gene UCSC Ensembl

Aliases

C6orf31, DSPD1, IFITMD7, NG5

Gene name

proline rich transmembrane protein 1

Alternate names

proline-rich transmembrane protein 1, dispanin subfamily D member 1, interferon induced transmembrane protein domain containing 7,

Gene location

6p21.32 (32153625: 32148327) Exons: 6 NC_000006.12

OMIM

604818

Protein Summary

Protein general information

Q99946

Name: Proline rich transmembrane protein 1 (Dispanin subfamily D member 1) (DSPD1)

Length: 306 Mass: 31430

Sequence

MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPAPPPQAAPSSHHHHHHHYHQSGTATLPRLGAGGLASSAATAQRGP
SSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEGPLPPPPPAAAAPPPPAPAQTAQAPGFVVPT
HAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTLPPPPQGPGLALLEPRRPPHDYMP
IAVLTTICCFWPTGIIAIFKAVQVRTALARGDMVSAEIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHH
ENYWDP

Structural information

Interpro:	IPR007593
STRING:	ENSP00000211413

Other Databases

GeneCards: PRRT1 Malacards: PRRT1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IBA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0099055	integral component of pos tsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21674046	Aberrant C pGs in Low Motility Sperm			18	Male infertility	GSE26881	Show abstract
29961538	Male facto r infertil ity			318 (128 couple s presenting wi th OAT (MF) and 118 maternal a ge-matched cont rol (no MF) sub jects undergoin g infertility t reatment, 72 su rplus cryoprese rved blastocyst s)	Male infertility	RNA-seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All