• Gene id: 80834

Gene Summary

• Gene Symbol: TAS1R2   Gene   UCSC   Ensembl
• Aliases: GPR71, T1R2, TR2
• Gene name: taste 1 receptor member 2
• Alternate names: taste receptor type 1 member 2, G-protein coupled receptor 71, sweet taste receptor T1R2, taste receptor, type 1, member 2,
• Gene location: 1p36.13 (4639504: 4655567)     Exons: 4     NC_000019.10
• OMIM: 606226

Protein Summary

• Protein general information: Q8TE23  
  • Name: Taste receptor type 1 member 2 (G protein coupled receptor 71) (Sweet taste receptor T1R2)
  • Length: 839  
  • Mass: 95183
• Sequence:

  MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCKEYEVKVIGYNLMQAM
  RFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDNLLPIQEDYSNYISRVVAVIGPDNSESVMTV
  ANFLSLFLLPQITYSAISDELRDKVRFPALLRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGE
  RVARRDICIAFQETLPTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWIA
  SESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPLSRTSQSYTCNQECDNCLNATLSFNT
  ILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQLLEEIWKVNFTLLDHQIFFDPQGDVALHLEI
  VQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTF
  LNHTEDEYECQACPNNEWSYQSETSCFKRQLVFLEWHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAG
  GPMCFLMLTLLLVAYMVVPVYVGPPKVSTCLCRQALFPLCFTICISCIAVRSFQIVCAFKMASRFPRAYSYWVRY
  QGPYVSMAFITVLKMVIVVIGMLATGLSPTTRTDPDDPKITIVSCNPNYRNSLLFNTSLDLLLSVVGFSFAYMGK
  ELPTNYNEAKFITLSMTFYFTSSVSLCTFMSAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPA
  YFNSMIQGYTMRRD

• Structural information:
  • Interpro: IPR001828  IPR000337  IPR011500  IPR038550  IPR017978   IPR017979  IPR028082  
  • Prosite: PS00980 PS50259
  • STRING: ENSP00000364520
• Other Databases: GeneCards:  TAS1R2  Malacards:  TAS1R2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050916	sensory perception of sweet taste	IDA	biological process
GO:0016021	integral component of membrane	IC	cellular component
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0008527	taste receptor activity	IPI	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IC	biological process
GO:0008527	taste receptor activity	IDA	contributes to
GO:0033041	sweet taste receptor activity	IDA	contributes to
GO:0001582	detection of chemical stimulus involved in sensory perception of sweet taste	IDA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:1903767	sweet taste receptor complex	IBA	cellular component
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0050916	sensory perception of sweet taste	IBA	biological process
GO:0033041	sweet taste receptor activity	IBA	contributes to
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0033041	sweet taste receptor activity	IEA	molecular function
GO:0050916	sensory perception of sweet taste	IEA	biological process
GO:1903767	sweet taste receptor complex	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction
hsa04973	Carbohydrate digestion and absorption

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq