• Gene id: 80833

Gene Summary

• Gene Symbol: APOL3   Gene   UCSC   Ensembl
• Aliases: APOLIII, CG121, CG12_1, apoL-III
• Gene name: apolipoprotein L3
• Alternate names: apolipoprotein L3, TNF-inducible protein CG12-1, apolipoprotein L, 3, apolipoprotein L-III, apolipoprotein L-III splice variant alpha, apolipoprotein L-III splice variant beta,
• Gene location: 22q12.3 (36166176: 36140322)     Exons: 10     NC_000022.11
• Gene summary(Entrez): This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or
• OMIM: 607253

Protein Summary

• Protein general information: O95236  
  • Name: Apolipoprotein L3 (Apolipoprotein L III) (ApoL III) (TNF inducible protein CG12 1) (CG12_1)
  • Length: 402  
  • Mass: 44278
  • Tissue specificity: Widely expressed; the highest levels are in prostate, lung and placenta; also detected in kidney, bone marrow, spleen, thymus, spinal cord, adrenal gland, salivary gland, trachea and mammary gland; levels are low in brain, heart, fetal
• Sequence:

  MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLE
  KKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYVQQKDEQFRE
  WFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVG
  LGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQ
  ARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEEL
  RRQAQELEENLMELTQIYQRLNPCHTH

• Structural information:
  • Interpro: IPR008405  
  • STRING: ENSP00000344577
• Other Databases: GeneCards:  APOL3  Malacards:  APOL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042157	lipoprotein metabolic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005319	lipid transporter activity	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)