• Gene id: 80830

Gene Summary

• Gene Symbol: APOL6   Gene   UCSC   Ensembl
• Aliases: APOL-VI, APOLVI
• Gene name: apolipoprotein L6
• Alternate names: apolipoprotein L6, apolipoprotein L, 6, apolipoprotein L-VI,
• Gene location: 22q12.3 (35648315: 35668405)     Exons: 4     NC_000022.11
• Gene summary(Entrez): This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. [provided by RefSeq, Jul 2008]
• OMIM: 603070

Protein Summary

• Protein general information: Q9BWW8  
  • Name: Apolipoprotein L6 (Apolipoprotein L VI) (ApoL VI)
  • Length: 343  
  • Mass: 38128
  • Tissue specificity: Widely expressed; highly expressed in the uterus, fetal brain and spinal cord, also detected in heart, liver, lung, colon, spleen, thymus, prostate, placenta, adrenal gland, salivary and mammary gland.
• Sequence:

  MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKTHKKFT
  KANMVATSTAVISGVMSLLGLALAPATGGGSLLLSTAGQGLATAAGVTSIVSGTLERSKNKEAQARAEDILPTYD
  QEDREDEEEKADYVTAAGKIIYNLRNTLKYAKKNVRAFWKLRANPRLANATKRLLTTGQVSSRSRVQVQKAFAGT
  TLAMTKNARVLGGVMSAFSLGYDLATLSKEWKHLKEGARTKFAEELRAKALELERKLTELTQLYKSLQQKVRSRA
  RGVGKDLTGTCETEAYWKELREHVWMWLWLCVCLCVCVYVQFT

• Structural information:
  • Interpro: IPR008405  
  • STRING: ENSP00000386280
• Other Databases: GeneCards:  APOL6  Malacards:  APOL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042157	lipoprotein metabolic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881