• Gene id: 80829

Gene Summary

• Gene Symbol: ZFP91   Gene   UCSC   Ensembl
• Aliases: DMS-8, DSM-8, FKSG11, PZF, ZFP-91, ZNF757
• Gene name: ZFP91 zinc finger protein, atypical E3 ubiquitin ligase
• Alternate names: E3 ubiquitin-protein ligase ZFP91, RING-type E3 ubiquitin transferase ZFP91, ZFP91 zinc finger protein, drug resistance-associated sequence in melanoma 8, penta zinc finger protein, zinc finger protein 757, zinc finger protein 91 homolog, zinc finger protein hom,
• Gene location: 11q12.1 (58579062: 58621549)     Exons: 11     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regul

Protein Summary

• Protein general information: Q96JP5  
  • Name: E3 ubiquitin protein ligase ZFP91 (EC 2.3.2.27) (RING type E3 ubiquitin transferase ZFP91) (Zinc finger protein 757) (Zinc finger protein 91 homolog) (Zfp 91)
  • Length: 570  
  • Mass: 63445
  • Tissue specificity: Expressed ubiquitously, particularly at high level in testis. Isoform 2 is testis specific.
• Sequence:

  MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAVAAAPAGTTSSRVLRGGRDRGRAAAAAAAAAVSRRRKAE
  YPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVTTDKDPKEEKEEEDDSALPQEVSIAASRPSR
  GWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDVGEEHQSPGGISSEEEEEEEEEMLISEEEIP
  FKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDEEPPRKRGRRRKDDKSPRLP
  KRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGRLFRLQKQLLRHAKHHTDQRDYICE
  YCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKA
  KSHPEVLIAEALAANAGALITSTDILGTNPESLTQPSDGQGLPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTER
  VSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDSDSAGP

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • PDB: 2M9A
  • PDBsum: 2M9A
  • STRING: ENSP00000339030
• Other Databases: GeneCards:  ZFP91  Malacards:  ZFP91

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray