• Gene id: 80824

Gene Summary

• Gene Symbol: DUSP16   Gene   UCSC   Ensembl
• Aliases: MKP-7, MKP7
• Gene name: dual specificity phosphatase 16
• Alternate names: dual specificity protein phosphatase 16, MAP kinase phosphatase 7, MAPK phosphatase-7, mitogen-activated protein kinase phosphatase 7,
• Gene location: 12p13.2 (12562862: 12473281)     Exons: 9     NC_000012.12
• Gene summary(Entrez): This gene encodes a mitogen-activated protein kinase phosphatase that is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphoty
• OMIM: 602069

Protein Summary

• Protein general information: Q9BY84  
  • Name: Dual specificity protein phosphatase 16 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen activated protein kinase phosphatase 7) (MAP kinase phosphatase 7) (MKP 7)
  • Length: 665  
  • Mass: 73102
• Sequence:

  MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKH
  KVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGGFAEFSRCFPGLCEGKSTLVPTCISQP
  CLPVANIGPTRILPNLYLGCQRDVLNKELMQQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDK
  SVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKN
  QTGASGPKSKLKLLHLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAAGQRPVHPASVPSVPSVQPSLLEDSP
  LVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGFSSSEDALEYYKPSTTLDGTNKLCQFSPVQE
  LSEQTPETSPDKEEASIPKKLQTARPSDSQSKRLHSVRTSSSGTAQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQ
  QHLTKSAGLGLKGWHSDILAPQTSTPSLTSSWYFATESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRR
  QKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS

• Structural information:
  • Protein Domains: (22..13-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (227..28-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR000340  IPR008343  IPR029021  IPR001763  IPR036873   IPR016130  IPR000387  IPR020422  
  • Prosite: PS50206 PS00383 PS50056 PS50054
  • PDB: 2VSW 3TG3 4YR8
  • PDBsum: 2VSW 3TG3 4YR8
  • STRING: ENSP00000298573
• Other Databases: GeneCards:  DUSP16  Malacards:  DUSP16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000188	inactivation of MAPK activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0008330	protein tyrosine/threonine phosphatase activity	IBA	molecular function
GO:0033550	MAP kinase tyrosine phosphatase activity	IBA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IBA	biological process
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0016311	dephosphorylation	IDA	biological process
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0043409	negative regulation of MAPK cascade	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IEA	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0000188	inactivation of MAPK activity	TAS	biological process
GO:0045204	MAPK export from nucleus	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0045209	MAPK phosphatase export from nucleus, leptomycin B sensitive	TAS	biological process
GO:0016311	dephosphorylation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray