• Gene id: 8078

Gene Summary

• Gene Symbol: USP5   Gene   UCSC   Ensembl
• Aliases: ISOT
• Gene name: ubiquitin specific peptidase 5
• Alternate names: ubiquitin carboxyl-terminal hydrolase 5, deubiquitinating enzyme 5, isopeptidase T, testicular tissue protein Li 218, ubiquitin isopeptidase T, ubiquitin specific protease 5 (isopeptidase T), ubiquitin thioesterase 5, ubiquitin thiolesterase 5, ubiquitin-specific,
• Gene location: 12p13.31 (6852137: 6866631)     Exons: 20     NC_000012.12
• Gene summary(Entrez): Ubiquitin (see MIM 191339)-dependent proteolysis is a complex pathway of protein metabolism implicated in such diverse cellular functions as maintenance of chromatin structure, receptor function, and degradation of abnormal proteins. A late step of the pr

Protein Summary

• Protein general information: P45974  
  • Name: Ubiquitin carboxyl terminal hydrolase 5 (EC 3.4.19.12) (Deubiquitinating enzyme 5) (Isopeptidase T) (Ubiquitin thioesterase 5) (Ubiquitin specific processing protease 5)
  • Length: 858  
  • Mass: 95786
• Sequence:

  MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVYLHLRR
  TRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSA
  VEALLSADSASRKQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFD
  GSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
  NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEKIFQNAPTDPTQDFST
  QVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERN
  CRSSENPNEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRA
  QVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
  QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVIIQLVEMGFPMDACRK
  AVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAADPPPEDCVTTIVSMGFSRDQALKALRATNN
  SLERAVDWIFSHIDDLDAEAAMDISEGRSAADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKK
  EGRWVIYNDQKVCASEKPPKDLGYIYFYQRVAS

• Structural information:
  • Protein Domains: (326..85-)
    (/note="USP-)
    (654..69-)
    (/note="UBA-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (722..76-)
    (/note="UBA-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212"-)
  • Interpro: IPR038765  IPR001394  IPR015940  IPR009060  IPR016652   IPR041432  IPR041812  IPR018200  IPR028889  IPR013083  IPR001607  
  • Prosite: PS50030 PS00972 PS00973 PS50235 PS50271
  • CDD: cd14383
  • PDB: 2DAG 2DAK 2G43 2G45 3IHP 6DXH 6DXT 6NFT 6P9G
  • PDBsum: 2DAG 2DAK 2G43 2G45 3IHP 6DXH 6DXT 6NFT 6P9G
  • DIP: 34459
  • STRING: ENSP00000229268
• Other Databases: GeneCards:  USP5  Malacards:  USP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0016579	protein deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0004197	cysteine-type endopeptidase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016579	protein deubiquitination	IBA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0005764	lysosome	TAS	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0071108	protein K48-linked deubiquitination	IMP	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray