• Gene id: 80772

Gene Summary

• Gene Symbol: CPTP   Gene   UCSC   Ensembl
• Aliases: GLTPD1
• Gene name: ceramide-1-phosphate transfer protein
• Alternate names: ceramide-1-phosphate transfer protein, GLTP domain-containing protein 1, glycolipid transfer protein domain containing 1, glycolipid transfer protein domain-containing protein 1,
• Gene location: 1p36.33 (1324756: 1328895)     Exons: 4     NC_000001.11
• OMIM: 615467

Protein Summary

• Protein general information: Q5TA50  
  • Name: Ceramide 1 phosphate transfer protein (CPTP) (Glycolipid transfer protein domain containing protein 1) (GLTP domain containing protein 1)
  • Length: 214  
  • Mass: 24365
  • Tissue specificity: Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. {ECO
• Sequence:

  MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGGPQSEH
  YRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDARTSALCADSYNASLAAYH
  PWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAEHSLLDLP

• Structural information:
  • Interpro: IPR036497  IPR014830  
  • PDB: 4K80 4K84 4K85 4K8N 4KBS 4KF6
  • PDBsum: 4K80 4K84 4K85 4K8N 4KBS 4KF6
  • STRING: ENSP00000343890
• Other Databases: GeneCards:  CPTP  Malacards:  CPTP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0008289	lipid binding	IBA	molecular function
GO:0120009	intermembrane lipid transfer	IBA	biological process
GO:1902387	ceramide 1-phosphate binding	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0035627	ceramide transport	IBA	biological process
GO:1902388	ceramide 1-phosphate transfer activity	IBA	molecular function
GO:1902387	ceramide 1-phosphate binding	IDA	molecular function
GO:0046836	glycolipid transport	IDA	NOT|biological process
GO:1902389	ceramide 1-phosphate transport	IDA	biological process
GO:1902388	ceramide 1-phosphate transfer activity	IDA	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:1900226	negative regulation of NLRP3 inflammasome complex assembly	IMP	biological process
GO:0050713	negative regulation of interleukin-1 beta secretion	IMP	biological process
GO:0010507	negative regulation of autophagy	IMP	biological process
GO:0120009	intermembrane lipid transfer	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0120013	lipid transfer activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1902388	ceramide 1-phosphate transfer activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	TAS	biological process
GO:0050713	negative regulation of interleukin-1 beta secretion	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)