• Gene id: 80765

Gene Summary

• Gene Symbol: STARD5   Gene   UCSC   Ensembl
• Gene name: StAR related lipid transfer domain containing 5
• Alternate names: stAR-related lipid transfer protein 5, START domain containing 5, START domain-containing protein 5, StAR-related lipid transfer (START) domain containing 5,
• Gene location: 15q25.1 (81324140: 81309052)     Exons: 6     NC_000015.10
• Gene summary(Entrez): Proteins containing a steroidogenic acute regulatory-related lipid transfer (START) domain are often involved in the trafficking of lipids and cholesterol between diverse intracellular membranes. This gene is a member of the StarD subfamily that encodes S
• OMIM: 602702

Protein Summary

• Protein general information: Q9NSY2  
  • Name: StAR related lipid transfer protein 5 (START domain containing protein 5) (StARD5)
  • Length: 213  
  • Mass: 23794
• Sequence:

  MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGL
  RVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVR
  GFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE

• Structural information:
  • Protein Domains: (1..21-)
    (/note="START-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00197"-)
  • Interpro: IPR029868  IPR023393  IPR002913  
  • Prosite: PS50848
  • PDB: 2R55
  • PDBsum: 2R55
  • STRING: ENSP00000304032
• Other Databases: GeneCards:  STARD5  Malacards:  STARD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0032052	bile acid binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0006869	lipid transport	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0015485	cholesterol binding	IDA	molecular function
GO:0120020	cholesterol transfer activity	IDA	molecular function
GO:0070508	cholesterol import	IDA	biological process
GO:0120009	intermembrane lipid transfer	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881