• Gene id: 80740

Gene Summary

• Gene Symbol: LY6G6C   Gene   UCSC   Ensembl
• Aliases: C6orf24, G6c, NG24
• Gene name: lymphocyte antigen 6 family member G6C
• Alternate names: lymphocyte antigen 6 complex locus protein G6c, lymphocyte antigen 6 complex, locus G6C, lymphocyte antigen-6 G6C,
• Gene location: 6p21.33 (155997630: 156013016)     Exons: 14     NC_000023.11
• Gene summary(Entrez): LY6G6C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
• OMIM: 610435

Protein Summary

• Protein general information: O95867  
  • Name: Lymphocyte antigen 6 complex locus protein G6c
  • Length: 125  
  • Mass: 13821
  • Tissue specificity: Highly expressed at the leading edges of cells, on filopodia. {ECO
• Sequence:

  MKALMLLTLSVLLCWVSADIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVFSNLRCGTPEEPCQEA
  FNQTNRKLGLTYNTTCCNKDNCNSAGPRPTPALGLVFLTSLAGLGLWLLH

• Structural information:
  • Protein Domains: (20..11-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR039237  
  • STRING: ENSP00000364978
• Other Databases: GeneCards:  LY6G6C  Malacards:  LY6G6C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032991	protein-containing complex	IBA	cellular component
GO:0009897	external side of plasma membrane	IBA	colocalizes with
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0009617	response to bacterium	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IDA	colocalizes with
GO:0032991	protein-containing complex	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)