• Gene id: 80725

Gene Summary

• Gene Symbol: SRCIN1   Gene   UCSC   Ensembl
• Aliases: P140, SNIP
• Gene name: SRC kinase signaling inhibitor 1
• Alternate names: SRC kinase signaling inhibitor 1, P130Cas-associated protein, SNAP-25-interacting protein, SNAP25-interacting protein, p140Cap,
• Gene location: 17q12 (38607165: 38530014)     Exons: 27     NC_000017.11
• OMIM: 608919

Protein Summary

• Protein general information: Q9C0H9  
  • Name: SRC kinase signaling inhibitor 1 (SNAP 25 interacting protein) (SNIP) (p130Cas associated protein) (p140Cap)
  • Length: 1183  
  • Mass: 127105
  • Tissue specificity: Expressed in some primary breast carcinomas where its presence is significantly associated with increased tumor size. Not detected in normal breast tissue. {ECO
• Sequence:

  MGNAPSQDPERSSPPMLSADDAEYPREYRTLGGGGGGGSGGRRFSNVGLVHTSERRHTVIAAQSLEALSGLQKAD
  ADRKRDAFMDHLKSKYPQHALALRGQQDRMREQPNYWSFKTRSSRHTQGAQPGLADQAAKLSYASAESLETMSEA
  ELPLGFSRMNRFRQSLPLSRSASQTKLRSPGVLFLQFGEETRRVHITHEVSSLDTLHALIAHMFPQKLTMGMLKS
  PNTAILIKDEARNVFYELEDVRDIQDRSIIKIYRKEPLYAAFPGSHLTNGDLRREMVYASRESSPTRRLNNLSPA
  PHLASGSPPPGLPSGLPSGLQSGSPSRSRLSYAGGRPPSYAGSPVHHAAERLGGAPAAQGVSPSPSAILERRDVK
  PDEDLASKAGGMVLVKGEGLYADPYGLLHEGRLSLAAAAGDPFAYPGAGGLYKRGSVRSLSTYSAAALQSDLEDS
  LYKAAGGGGPLYGDGYGFRLPPSSPQKLADVAAPPGGPPPPHSPYSGPPSRGSPVRQSFRKDSGSSSVFAESPGG
  KTRSAGSASTAGAPPSELFPGPGERSLVGFGPPVPAKDTETRERMEAMEKQIASLTGLVQSALLRGSEPETPSEK
  IEGSNGAATPSAPCGSGGRSSGATPVSGPPPPSASSTPAGQPTAVSRLQMQLHLRGLQNSASDLRGQLQQLRKLQ
  LQNQESVRALLKRTEAELSMRVSEAARRQEDPLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVSHN
  HRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQI
  RRQVDEGVWPPPNNLLSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKR
  SVDKAVSVEAAERDWEEKRAALTQYSAKDINRLLEETQAELLKAIPDLDCASKAHPGPAPTPDHKPPKAPHGQKA
  APRTEPSGRRGSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGLTTTRTGEVVVTSKKDSAFIKKAESEELEVQK
  PQVKLRRAVSEVARPASTPPIMASAIKDEDDEDRIIAELESGGGSVPPMKVVTPGASRLKAAQGQAGSPDKSKHG
  KQRAEYMRIQAQQQATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSISF

• Structural information:
  • Interpro: IPR022782  IPR026727  
  • STRING: ENSP00000484715
• Other Databases: GeneCards:  SRCIN1  Malacards:  SRCIN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030334	regulation of cell migration	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0061001	regulation of dendritic spine morphogenesis	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0005925	focal adhesion	IDA	NOT|cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0050709	negative regulation of protein secretion	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0061098	positive regulation of protein tyrosine kinase activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0061099	negative regulation of protein tyrosine kinase activity	IDA	biological process
GO:0019901	protein kinase binding	IDA	molecular function
GO:0061001	regulation of dendritic spine morphogenesis	IMP	biological process
GO:0045202	synapse	ISS	cellular component
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0030334	regulation of cell migration	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq