• Gene id: 80723

Gene Summary

• Gene Symbol: SLC35G2   Gene   UCSC   Ensembl
• Aliases: TMEM22
• Gene name: solute carrier family 35 member G2
• Alternate names: solute carrier family 35 member G2, transmembrane protein 22,
• Gene location: 3q22.3 (49673101: 49683970)     Exons: 22     NC_000003.12
• OMIM: 617812

Protein Summary

• Protein general information: Q8TBE7  
  • Name: Solute carrier family 35 member G2 (Transmembrane protein 22)
  • Length: 412  
  • Mass: 46422
• Sequence:

  MDTSPSRKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEGYGNFMEENPKKGLLSEMKKKGRAFFGTMDTL
  PPPTEDPMINEIGQFQSFAEKNIFQSRKMWIVLFGSALAHGCVALITRLVSDRSKVPSLELIFIRSVFQVLSVLV
  VCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILAFLLVDEKMAYVDMAT
  VVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKEKISMWTALFTFGWTGTIWGI
  STMFILQEPIIPLDGETWSYLIAICVCSTAAFLGVYYALDKFHPALVSTVQHLEIVVAMVLQLLVLHIFPSIYDV
  FGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSPIK

• Structural information:
  • Protein Domains: (119..23-)
    (/note="EamA-1)
    (/evidence="ECO:0000255-)
    (268..38-)
    (/note="EamA-2)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR000620  
  • STRING: ENSP00000400839
• Other Databases: GeneCards:  SLC35G2  Malacards:  SLC35G2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq