• Gene id: 8048

Gene Summary

• Gene Symbol: CSRP3   Gene   UCSC   Ensembl
• Aliases: CLP, CMD1M, CMH12, CRP3, LMO4, MLP
• Gene name: cysteine and glycine rich protein 3
• Alternate names: cysteine and glycine-rich protein 3, LIM domain only 4, cardiac LIM domain protein, cysteine and glycine-rich protein 3 (cardiac LIM protein), muscle lim protein isoform,
• Gene location: 11p15.1 (19201982: 19182029)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of prote
• OMIM: 600824

Protein Summary

• Protein general information: P50461  
  • Name: Cysteine and glycine rich protein 3 (Cardiac LIM protein) (Cysteine rich protein 3) (CRP3) (LIM domain protein, cardiac) (Muscle LIM protein)
  • Length: 194  
  • Mass: 20969
  • Tissue specificity: Cardiac and slow-twitch skeletal muscles. Isoform 2 is expressed in striated muscle. Isoform 2 is specifically expressed at higher levels in patients with neuromuscular diseases, such as limb-girdle muscular dystrophy 2A (LGMD2A), Duch
• Sequence:

  MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGYGQ
  GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAIC
  GKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE

• Structural information:
  • Protein Domains: (10..6-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (120..17-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125"-)
  • Interpro: IPR001781  
  • Prosite: PS00478 PS50023
  • PDB: 2O10 2O13
  • PDBsum: 2O10 2O13
  • STRING: ENSP00000431813
• Other Databases: GeneCards:  CSRP3  Malacards:  CSRP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008307	structural constituent of muscle	IBA	molecular function
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0042805	actinin binding	IBA	molecular function
GO:0060537	muscle tissue development	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0030018	Z disc	IBA	cellular component
GO:0045214	sarcomere organization	IBA	biological process
GO:0060048	cardiac muscle contraction	IBA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0007517	muscle organ development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007519	skeletal muscle tissue development	TAS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070528	protein kinase C signaling	IEA	biological process
GO:0055003	cardiac myofibril assembly	IEA	biological process
GO:0042805	actinin binding	IEA	molecular function
GO:0042593	glucose homeostasis	IEA	biological process
GO:0035995	detection of muscle stretch	IEA	biological process
GO:0033292	T-tubule organization	IEA	biological process
GO:0008307	structural constituent of muscle	IEA	molecular function
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:1903076	regulation of protein localization to plasma membrane	IEA	biological process
GO:0060048	cardiac muscle contraction	IEA	biological process
GO:0048738	cardiac muscle tissue development	IEA	biological process
GO:0033365	protein localization to organelle	IEA	biological process
GO:0031433	telethonin binding	IEA	molecular function
GO:0030018	Z disc	IEA	cellular component
GO:0007507	heart development	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0002026	regulation of the force of heart contraction	IEA	biological process
GO:0008307	structural constituent of muscle	IMP	molecular function
GO:0042805	actinin binding	ISS	molecular function
GO:0031433	telethonin binding	IDA	molecular function
GO:0031433	telethonin binding	IPI	molecular function
GO:0006874	cellular calcium ion homeostasis	ISS	biological process
GO:0035995	detection of muscle stretch	IMP	biological process
GO:0055003	cardiac myofibril assembly	ISS	biological process
GO:0030018	Z disc	IDA	cellular component
GO:0002026	regulation of the force of heart contraction	ISS	biological process
GO:0003300	cardiac muscle hypertrophy	IMP	biological process
GO:0033365	protein localization to organelle	IMP	biological process
GO:0048738	cardiac muscle tissue development	ISS	biological process
GO:0060048	cardiac muscle contraction	IMP	biological process
GO:0030017	sarcomere	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030018	Z disc	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Dilated cardiomyopathy	KEGG:H00294
Hypertrophic cardiomyopathy	KEGG:H00292
Dilated cardiomyopathy	KEGG:H00294
Hypertrophic cardiomyopathy	KEGG:H00292
hypertrophic cardiomyopathy	PMID:12642359
Cardiomyopathy	PMID:12507422
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray