• Gene id: 80380

Gene Summary

• Gene Symbol: PDCD1LG2   Gene   UCSC   Ensembl
• Aliases: B7DC, Btdc, CD273, PD-L2, PDCD1L2, PDL2, bA574F11.2
• Gene name: programmed cell death 1 ligand 2
• Alternate names: programmed cell death 1 ligand 2, B7 dendritic cell molecule, B7-DC, PD-1-ligand 2, PDCD1 ligand 2, butyrophilin B7-DC, programmed death ligand 2,
• Gene location: 9p24.1 (5510437: 5571281)     Exons: 7     NC_000009.12
• OMIM: 605723

Protein Summary

• Protein general information: Q9BQ51  
  • Name: Programmed cell death 1 ligand 2 (PD 1 ligand 2) (PD L2) (PDCD1 ligand 2) (Programmed death ligand 2) (Butyrophilin B7 DC) (B7 DC) (CD antigen CD273)
  • Length: 273  
  • Mass: 30957
  • Tissue specificity: Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus. {ECO
• Sequence:

  MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATL
  LEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPL
  AEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHI
  FIPFCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI

• Structural information:
  • Protein Domains: (21..11-)
    (/note="Ig-like-V-type)
    (122..20-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR013162  IPR007110  IPR036179  IPR013783  IPR003599  
  • Prosite: PS50835
  • PDB: 6UMT
  • PDBsum: 6UMT
  • STRING: ENSP00000380855
• Other Databases: GeneCards:  PDCD1LG2  Malacards:  PDCD1LG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0031295	T cell costimulation	IBA	biological process
GO:0042130	negative regulation of T cell proliferation	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0046007	negative regulation of activated T cell proliferation	IMP	biological process
GO:0032693	negative regulation of interleukin-10 production	IMP	biological process
GO:0032689	negative regulation of interferon-gamma production	IMP	biological process
GO:0006955	immune response	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881