• Gene id: 8036

Gene Summary

• Gene Symbol: SHOC2   Gene   UCSC   Ensembl
• Aliases: SIAA0862, SOC2, SUR8
• Gene name: SHOC2 leucine rich repeat scaffold protein
• Alternate names: leucine-rich repeat protein SHOC-2, soc-2 suppressor of clear homolog,
• Gene location: 10q25.2 (114439466: 114450278)     Exons: 7     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that consists almost entirely of leucine-rich repeats, a domain implicated in protein-protein interactions. The protein may function as a scaffold linking RAS to downstream signal transducers in the RAS/ERK MAP kinase signaling
• OMIM: 602775

Protein Summary

• Protein general information: Q9UQ13  
  • Name: Leucine rich repeat protein SHOC 2 (Protein soc 2 homolog) (Protein sur 8 homolog)
  • Length: 582  
  • Mass: 64888
• Sequence:

  MSSSLGKEKDSKEKDPKVPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAAQPGVAFSVDNTIKRP
  NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMT
  LALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIREN
  KIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIP
  RSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIF
  SRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKL
  RELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLN
  DNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV

• Structural information:
  • Interpro: IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000358464
• Other Databases: GeneCards:  SHOC2  Malacards:  SHOC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008157	protein phosphatase 1 binding	IBA	molecular function
GO:0046579	positive regulation of Ras protein signal transduction	IBA	biological process
GO:0000164	protein phosphatase type 1 complex	IDA	cellular component
GO:0008157	protein phosphatase 1 binding	IDA	molecular function
GO:0000164	protein phosphatase type 1 complex	IDA	cellular component
GO:0019903	protein phosphatase binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0046579	positive regulation of Ras protein signal transduction	IMP	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IMP	biological process
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0005737	cytoplasm	NAS	cellular component
GO:0007265	Ras protein signal transduction	NAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway

Diseases

Associated diseases	References
Noonan syndrome and related disorders	KEGG:H00523
Noonan-like syndrome with loose anagen hair	KEGG:H02191
Noonan syndrome and related disorders	KEGG:H00523
Noonan-like syndrome with loose anagen hair	KEGG:H02191
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)