• Gene id: 80349

Gene Summary

• Gene Symbol: WDR61   Gene   UCSC   Ensembl
• Aliases: REC14, SKI8
• Gene name: WD repeat domain 61
• Alternate names: WD repeat-containing protein 61, SKI8 homolog, meiotic recombination REC14 protein homolog, recombination protein REC14,
• Gene location: 15q25.1 (78299702: 78283232)     Exons: 11     NC_000015.10
• Gene summary(Entrez): WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 [PubMed 16024656]).[supplied by OMIM, Mar 2008]
• OMIM: 609540

Protein Summary

• Protein general information: Q9GZS3  
  • Name: WD repeat containing protein 61 (Meiotic recombination REC14 protein homolog) (SKI8 homolog) (Ski8) [Cleaved into: WD repeat containing protein 61, N terminally processed]
  • Length: 305  
  • Mass: 33581
• Sequence:

  MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHT
  LPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKF
  ILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLA
  GTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHI
  YDCPI

• Structural information:
  • Interpro: IPR020472  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 3OW8 6GMH
  • PDBsum: 3OW8 6GMH
  • DIP: 36672
  • STRING: ENSP00000267973
• Other Databases: GeneCards:  WDR61  Malacards:  WDR61

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035327	transcriptionally active chromatin	IDA	cellular component
GO:0055087	Ski complex	IDA	cellular component
GO:0045638	negative regulation of myeloid cell differentiation	IDA	biological process
GO:0016593	Cdc73/Paf1 complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0080182	histone H3-K4 trimethylation	IMP	biological process
GO:0051571	positive regulation of histone H3-K4 methylation	IMP	biological process
GO:2001162	positive regulation of histone H3-K79 methylation	IMP	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016593	Cdc73/Paf1 complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)