• Gene id: 80341

Gene Summary

• Gene Symbol: BPIFB2   Gene   UCSC   Ensembl
• Aliases: BPIL1, C20orf184, LPLUNC2, RYSR, dJ726C3.2
• Gene name: BPI fold containing family B member 2
• Alternate names: BPI fold-containing family B member 2, BPI-like 1, bactericidal/permeability-increasing protein-like 1, long palate, lung and nasal epithelium carcinoma-associated protein 2,
• Gene location: 20q11.21 (33007703: 33023702)     Exons: 16     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromos
• OMIM: 609692

Protein Summary

• Protein general information: Q8N4F0  
  • Name: BPI fold containing family B member 2 (Bactericidal/permeability increasing protein like 1) (BPI like 1) (Long palate, lung and nasal epithelium carcinoma associated protein 2) (RYSR)
  • Length: 458  
  • Mass: 49172
  • Tissue specificity: Highly expressed in tonsils, especially in hypertrophic tonsils. Detected at very low levels in fetal liver. {ECO
• Sequence:

  MAWASRLGLLLALLLPVVGASTPGTVVRLNKAALSYVSEIGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVH
  VPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGS
  NSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAV
  LFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRL
  IPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPFVEVLATASNSAFQSLFSLDVVVNLRLQLSVSKVKL
  QGTTSVLGDVQLTVASSNVGFIDTDQVRTLMGTVFEKPLLDHLNALLAMGIALPGVVNLHYVAPEIFVYEGYVVI
  SSGLFYQS

• Structural information:
  • Interpro: IPR017943  IPR030675  IPR001124  IPR017942  
  • STRING: ENSP00000170150
• Other Databases: GeneCards:  BPIFB2  Malacards:  BPIFB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq