• Gene id: 8034

Gene Summary

• Gene Symbol: SLC25A16   Gene   UCSC   Ensembl
• Aliases: D10S105E, GDA, GDC, HGT.1, ML7, hML7
• Gene name: solute carrier family 25 member 16
• Alternate names: graves disease carrier protein, mitochondrial solute carrier protein homolog, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16,
• Gene location: 10q21.3 (68527522: 68477997)     Exons: 10     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitoc
• OMIM: 602617

Protein Summary

• Protein general information: P16260  
  • Name: Graves disease carrier protein (GDC) (Graves disease autoantigen) (GDA) (Mitochondrial solute carrier protein homolog) (Solute carrier family 25 member 16)
  • Length: 332  
  • Mass: 36224
• Sequence:

  MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHHYKHLG
  VFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMAGMTAVICTYP
  LDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLL
  GRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL
  YRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN

• Structural information:
  • Interpro: IPR002167  IPR002067  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000476815
• Other Databases: GeneCards:  SLC25A16  Malacards:  SLC25A16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005347	ATP transmembrane transporter activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0015291	secondary active transmembrane transporter activity	TAS	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0015867	ATP transport	IEA	biological process
GO:0015297	antiporter activity	NAS	molecular function
GO:0006839	mitochondrial transport	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881