• Gene id: 80335

Gene Summary

• Gene Symbol: WDR82   Gene   UCSC   Ensembl
• Aliases: MST107, MSTP107, PRO2730, PRO34047, SWD2, TMEM113, WDR82A
• Gene name: WD repeat domain 82
• Alternate names: WD repeat-containing protein 82, transmembrane protein 113,
• Gene location: 3p21.2 (18507481: 18561414)     Exons: 22     NC_000020.11
• Gene summary(Entrez): TMEM113 (WDR82) is a component of the mammalian SET1A (MIM 611052)/SET1B (MIM 611055) histone H3-Lys4 methyltransferase complexes (Lee and Skalnik, 2005 [PubMed 16253997]; Lee et al., 2007 [PubMed 17355966]).[supplied by OMIM, Jul 2010]
• OMIM: 611059

Protein Summary

• Protein general information: Q6UXN9  
  • Name: WD repeat containing protein 82 (Protein TMEM113) (Swd2)
  • Length: 313  
  • Mass: 35079
• Sequence:

  MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAA
  NTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGK
  PVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFK
  GVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASA
  CSNMAFWLPTIDD

• Structural information:
  • Interpro: IPR020472  IPR037867  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000296490
• Other Databases: GeneCards:  WDR82  Malacards:  WDR82

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0080182	histone H3-K4 trimethylation	IBA	biological process
GO:0042800	histone methyltransferase activity (H3-K4 specific)	IBA	contributes to
GO:0003682	chromatin binding	IBA	molecular function
GO:0048188	Set1C/COMPASS complex	IBA	cellular component
GO:0072357	PTW/PP1 phosphatase complex	IDA	cellular component
GO:0048188	Set1C/COMPASS complex	IDA	cellular component
GO:0048188	Set1C/COMPASS complex	IDA	cellular component
GO:0000785	chromatin	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048188	Set1C/COMPASS complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0051568	histone H3-K4 methylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003682	chromatin binding	IEA	molecular function
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0051568	histone H3-K4 methylation	IDA	biological process
GO:0042800	histone methyltransferase activity (H3-K4 specific)	IDA	contributes to
GO:0035097	histone methyltransferase complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R