• Gene id: 80333

Gene Summary

• Gene Symbol: KCNIP4   Gene   UCSC   Ensembl
• Aliases: CALP, KCHIP4
• Gene name: potassium voltage-gated channel interacting protein 4
• Alternate names: Kv channel-interacting protein 4, Kv channel interacting protein 4, a-type potassium channel modulatory protein 4, calsenilin-like protein,
• Gene location: 4p15.31-p15.2 (41690491: 41673932)     Exons: 6     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have
• OMIM: 608182

Protein Summary

• Protein general information: Q6PIL6  
  • Name: Kv channel interacting protein 4 (KChIP4) (A type potassium channel modulatory protein 4) (Calsenilin like protein) (Potassium channel interacting protein 4)
  • Length: 250  
  • Mass: 28729
  • Tissue specificity: Predominantly expressed in brain. {ECO
• Sequence:

  MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALEL
  LEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLS
  ILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVT
  IDEFIESCQKDENIMRSMQLFENVI

• Structural information:
  • Protein Domains: (61..11-)
    (/note="EF-hand-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (120..15-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (156..19-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR028846  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000371587
• Other Databases: GeneCards:  KCNIP4  Malacards:  KCNIP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:0008076	voltage-gated potassium channel complex	ISS	cellular component
GO:0015459	potassium channel regulator activity	ISS	molecular function
GO:1901379	regulation of potassium ion transmembrane transport	ISS	biological process
GO:0008076	voltage-gated potassium channel complex	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0015459	potassium channel regulator activity	ISS	molecular function
GO:1901379	regulation of potassium ion transmembrane transport	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0061337	cardiac conduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:1901379	regulation of potassium ion transmembrane transport	IEA	biological process
GO:0015459	potassium channel regulator activity	IEA	molecular function
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R