• Gene id: 80332

Gene Summary

• Gene Symbol: ADAM33   Gene   UCSC   Ensembl
• Aliases: C20orf153, DJ964F7.1
• Gene name: ADAM metallopeptidase domain 33
• Alternate names: disintegrin and metalloproteinase domain-containing protein 33, ADAM 33, a disintegrin and metalloprotease 33, a disintegrin and metalloproteinase domain 33, disintegrin and reprolysin metalloproteinase family protein,
• Gene location: 20p13 (3682107: 3667972)     Exons: 22     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes
• OMIM: 602714

Protein Summary

• Protein general information: Q9BZ11  
  • Name: Disintegrin and metalloproteinase domain containing protein 33 (ADAM 33) (EC 3.4.24. )
  • Length: 813  
  • Mass: 87739
  • Tissue specificity: Expressed in all tissues, except liver, with high expression in placenta, lung, spleen and veins. {ECO
• Sequence:

  MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVALEAEGQ
  ELLLELEKNHRLLAPGYIETHYGPDGQPVVLAPNHTDHCHYQGRVRGFPDSWVVLCTCSGMSGLITLSRNASYYL
  RPWPPRGSKDFSTHEIFRMEQLLTWKGTCGHRDPGNKAGMTSLPGGPQSRGRREARRTRKYLELYIVADHTLFLT
  RHRNLNHTKQRLLEVANYVDQLLRTLDIQVALTGLEVWTERDRSRVTQDANATLWAFLQWRRGLWAQRPHDSAQL
  LTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMAHEIGHSLGLSHDPDGCCVEAAAESGGCVMAA
  ATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGLPVPPALCGNGFVEAGEECDCGPGQECRDLCCFAHNCS
  LRPGAQCAHGDCCVRCLLKPAGALCRQAMGDCDLPEFCTGTSSHCPPDVYLLDGSPCARGSGYCWDGACPTLEQQ
  CQQLWGPGSHPAPEACFQVVNSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLD
  GQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQELQRCLTACHSHGVCNSNHNCHCAPGW
  APPFCDKPGFGGSMDSGPVQAENHDTFLLAMLLSVLLPLLPGAGLAWCCYRLPGAHLQRCSWGCRRDPACSGPKD
  GPHRDHPLGGVHPMELGPTATGQPWPLDPENSHEPSSHPEKPLPAVSPDPQADQVQMPRSCLW

• Structural information:
  • Protein Domains: (210..40-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (417..50-)
    (/note="Disintegrin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00068-)
    (649..68-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR006586  IPR018358  IPR001762  IPR036436  IPR013032   IPR000742  IPR024079  IPR001590  IPR002870  IPR034027  
  • Prosite: PS50215 PS00427 PS50214 PS01186 PS50026 PS00142
  • CDD: cd04269
  • PDB: 1R54 1R55
  • PDBsum: 1R54 1R55
  • STRING: ENSP00000348912
• Other Databases: GeneCards:  ADAM33  Malacards:  ADAM33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0004222	metalloendopeptidase activity	NAS	molecular function
GO:0008270	zinc ion binding	NAS	molecular function
GO:0006508	proteolysis	NAS	biological process

Diseases

Associated diseases	References
Asthma	KEGG:H00079
Asthma	KEGG:H00079
Asthma	PMID:17339047
Asthma	PMID:17961406
Chronic obstructive pulmonary disease	PMID:20003279
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq