• Gene id: 80329

Gene Summary

• Gene Symbol: ULBP1   Gene   UCSC   Ensembl
• Aliases: N2DL-1, NKG2DL1, RAET1I
• Gene name: UL16 binding protein 1
• Alternate names: UL16-binding protein 1, NKG2D ligand 1, alcan-beta, retinoic acid early transcript 1I,
• Gene location: 6q25.1 (149963942: 149973714)     Exons: 5     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of the encoded ligand to NKG2D leads to activation of several signal transduction pathways, inc
• OMIM: 173490

Protein Summary

• Protein general information: Q9BZM6  
  • Name: UL16 binding protein 1 (ALCAN beta) (NKG2D ligand 1) (N2DL 1) (NKG2DL1) (Retinoic acid early transcript 1I)
  • Length: 244  
  • Mass: 27997
  • Tissue specificity: Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.
• Sequence:

  MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFA
  SLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLL
  FDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMAT
  TLSPWSLLIIFLCFILAGR

• Structural information:
  • Interpro: IPR011161  IPR037055  IPR011162  
  • STRING: ENSP00000229708
• Other Databases: GeneCards:  ULBP1  Malacards:  ULBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030101	natural killer cell activation	IDA	biological process
GO:0046703	natural killer cell lectin-like receptor binding	IDA	molecular function
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0042267	natural killer cell mediated cytotoxicity	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04650	Natural killer cell mediated cytotoxicity

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray