• Gene id: 80326

Gene Summary

• Gene Symbol: WNT10A   Gene   UCSC   Ensembl
• Aliases: OODD, SSPS, STHAG4
• Gene name: Wnt family member 10A
• Alternate names: protein Wnt-10a, wingless-type MMTV integration site family, member 10A,
• Gene location: 2q35 (55038263: 55013704)     Exons: 8     NC_000019.10
• Gene summary(Entrez): The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog
• OMIM: 606268

Protein Summary

• Protein general information: Q9GZT5  
  • Name: Protein Wnt 10a
  • Length: 417  
  • Mass: 46444
• Sequence:

  MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTVCLTLPGLSRRQMEVC
  VRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA
  LGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFS
  KDFLDSREPHRDIHARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
  RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGRLCNKSSAGSDGCGSM
  CCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK

• Structural information:
  • Interpro: IPR005817  IPR013302  IPR018161  
  • Prosite: PS00246
  • STRING: ENSP00000258411
• Other Databases: GeneCards:  WNT10A  Malacards:  WNT10A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045165	cell fate commitment	IBA	biological process
GO:0005109	frizzled binding	IBA	molecular function
GO:0030182	neuron differentiation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0014033	neural crest cell differentiation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0042487	regulation of odontogenesis of dentin-containing tooth	IEA	biological process
GO:0001942	hair follicle development	IMP	biological process
GO:0001942	hair follicle development	IMP	biological process
GO:0031069	hair follicle morphogenesis	IMP	biological process
GO:0048730	epidermis morphogenesis	IMP	biological process
GO:0042476	odontogenesis	IMP	biological process
GO:0042476	odontogenesis	IMP	biological process
GO:0043586	tongue development	IMP	biological process
GO:0043586	tongue development	IMP	biological process
GO:0043588	skin development	IMP	biological process
GO:0043588	skin development	IMP	biological process
GO:0048733	sebaceous gland development	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Tooth agenesis	KEGG:H00625
Odontoonychodermal dysplasia	KEGG:H00646
Schopf-Schulz-Passarge syndrome	KEGG:H00781
Tooth agenesis	KEGG:H00625
Odontoonychodermal dysplasia	KEGG:H00646
Schopf-Schulz-Passarge syndrome	KEGG:H00781
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)