• Gene id: 80318

Gene Summary

• Gene Symbol: GKAP1   Gene   UCSC   Ensembl
• Aliases: FKSG21, GKAP42
• Gene name: G kinase anchoring protein 1
• Alternate names: G kinase-anchoring protein 1, cGMP-dependent protein kinase anchoring protein 42kDa, cGMP-dependent protein kinase-anchoring protein of 42 kDa, protein kinase anchoring protein GKAP42,
• Gene location: 9q21.32 (67558726: 67607336)     Exons: 10     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse test
• OMIM: 611356

Protein Summary

• Protein general information: Q5VSY0  
  • Name: G kinase anchoring protein 1 (cGMP dependent protein kinase anchoring protein of 42 kDa)
  • Length: 366  
  • Mass: 42078
• Sequence:

  MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEANELRN
  LAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYED
  AENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREK
  RREQLTEYNGTDNCTAHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEG
  EMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR

• Structural information:
  • Interpro: IPR026109  
  • DIP: 47324
  • STRING: ENSP00000365550
• Other Databases: GeneCards:  GKAP1  Malacards:  GKAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0007165	signal transduction	ISS	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	ISS	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046628	positive regulation of insulin receptor signaling pathway	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray