• Gene id: 80310

Gene Summary

• Gene Symbol: PDGFD   Gene   UCSC   Ensembl
• Aliases: IEGF, MSTP036, SCDGF-B, SCDGFB
• Gene name: platelet derived growth factor D
• Alternate names: platelet-derived growth factor D, PDGF-D, iris-expressed growth factor, spinal cord-derived growth factor B,
• Gene location: 11q22.3 (33774519: 33740943)     Exons: 14     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f
• OMIM: 609673

Protein Summary

• Protein general information: Q9GZP0  
  • Name: Platelet derived growth factor D (PDGF D) (Iris expressed growth factor) (Spinal cord derived growth factor B) (SCDGF B) [Cleaved into: Platelet derived growth factor D, latent form (PDGFD latent form); Platelet derived growth factor D, receptor binding f
  • Length: 370  
  • Mass: 42848
  • Tissue specificity: Expressed at high levels in the heart, pancreas, adrenal gland and ovary and at low levels in placenta, liver, kidney, prostate, testis, small intestine, spleen and colon. In the kidney, expressed by the visceral epithelial cells of th
• Sequence:

  MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPR
  NLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGRWCGHKEVPPRIKSRTNQIKIT
  FKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLK
  YFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
  RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

• Structural information:
  • Protein Domains: (52..17-)
    (/note="CUB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059"-)
  • Interpro: IPR000859  IPR029034  IPR000072  IPR027123  IPR035914  
  • Prosite: PS01180 PS50278
  • CDD: cd00041 cd00135
  • STRING: ENSP00000376865
• Other Databases: GeneCards:  PDGFD  Malacards:  PDGFD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005161	platelet-derived growth factor receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IBA	biological process
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0031954	positive regulation of protein autophosphorylation	IBA	biological process
GO:0043406	positive regulation of MAP kinase activity	IBA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0070851	growth factor receptor binding	IBA	molecular function
GO:0005161	platelet-derived growth factor receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:2000439	positive regulation of monocyte extravasation	IEA	biological process
GO:0071673	positive regulation of smooth muscle cell chemotaxis	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0072126	positive regulation of glomerular mesangial cell proliferation	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa04510	Focal adhesion
hsa04072	Phospholipase D signaling pathway
hsa05231	Choline metabolism in cancer
hsa04540	Gap junction
hsa05215	Prostate cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05218	Melanoma

Diseases

Associated diseases	References
Prostate cancer	PMID:21098708
Prostatic hypertrophy	PMID:22689130
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq